LUZP4 (leucine zipper protein 4)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 51213
Gene name Leucine zipper protein 4
Gene symbol LUZP4
Synonyms (NCBI Gene)
CT-28CT-8CT28HOM-TES-85
Chromosome X
Chromosome location Xq23
Summary This gene encodes a leucine-zipper protein that was first defined as a cancer testis antigens. The encoded protein is an RNA binding protein that interacts with the mRNA export receptor nuclear RNA export factor 2. Alternate splicing results in multiple t
miRNA miRNA information provided by mirtarbase database.
10 Show/Hide all (10)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1122641 hsa-miR-1197 CLIP-seq
MIRT1122642 hsa-miR-224 CLIP-seq
MIRT1122643 hsa-miR-3117-5p CLIP-seq
MIRT1122644 hsa-miR-4436a CLIP-seq
MIRT1122645 hsa-miR-4700-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding IEA
GO:0005515 Function Protein binding IPI 25416956, 25910212, 32296183
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
GO:0051028 Process MRNA transport IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
300616 24971 ENSG00000102021
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9P127
Protein name Leucine zipper protein 4 (Cancer/testis antigen 28) (CT-28) (CT28) (Tumor antigen HOM-TES-85)
Protein function Export adapter involved in mRNA nuclear export in cancer cells. Binds and enhances the RNA-binding activity of the nuclear RNA export factor NXF1. Can restore mRNA export function in cells compromised by loss of mRNA export adapters (PubMed:2566
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed specifically in testis. Also expressed in a wide variety of cancer types, but particularly high levels of expression observed in melanoma cells. {ECO:0000269|PubMed:12032826, ECO:0000269|PubMed:25662211}.
Sequence 
MASFRKLTLSEKVPPNHPSRKKVNFLDMSLDDIIIYKELEGTNAEEEKNKRQNHSKKESP
SRQQSKAHRHRHRRGYSRCRSNSEEGNHDKKPSQKPSGFKSGQHPLNGQPLIEQEKCSDN
YEAQAEKNQGQSEGNQHQSEGNPDKSEESQGQPEENHHSERSRNHLERSLSQSDRSQGQL
KRHHPQYERSHGQYKRSHGQSERSHGHSERSHGHSERSHGHSERSHGHSKRSRSQGDLVD
TQSDLIATQRDLIATQKDLIATQRDLIATQRDLIVTQRDLVATERDLINQSGRSHGQSER
HQRYSTGKNTITT
Sequence length 313
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Transport of Mature mRNA derived from an Intron-Containing Transcript
mRNA 3'-end processing
RNA Polymerase II Transcription Termination
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
LUZP4-related disorder Likely benign; Benign ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Show/Hide Text Mining Associations (6)
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Colorectal Neoplasms Colorectal neoplasm Pubtator 34080453, 35937946 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of testis Malignant Neoplasm Of Testis BEFREE 16094643
★★★★★
★☆☆☆☆
Found in Text Mining only
Melanoma Melanoma Pubtator 25662211 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Multiple Myeloma Multiple myeloma Pubtator 24889268 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck Squamous cell carcinoma Pubtator 16929165 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Testicular Neoplasms Testicular neoplasm Pubtator 23619976 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Sort by:
DDX39A 3 shared pathwaysTransport of Mature mRNA derived from an Intron-Containing Transcript, mRNA 3'-end processing, RNA Polymerase II Transcription Termination Related via 3 shared pathways including Transport of Mature mRNA derived from an Intron-Containing Transcript, mRNA 3'-end processing. CHTOP 3 shared pathwaysTransport of Mature mRNA derived from an Intron-Containing Transcript, mRNA 3'-end processing, RNA Polymerase II Transcription Termination Related via 3 shared pathways including Transport of Mature mRNA derived from an Intron-Containing Transcript, mRNA 3'-end processing. FYTTD1 3 shared pathwaysTransport of Mature mRNA derived from an Intron-Containing Transcript, mRNA 3'-end processing, RNA Polymerase II Transcription Termination Related via 3 shared pathways including Transport of Mature mRNA derived from an Intron-Containing Transcript, mRNA 3'-end processing. POLDIP3 3 shared pathwaysTransport of Mature mRNA derived from an Intron-Containing Transcript, mRNA 3'-end processing, RNA Polymerase II Transcription Termination Related via 3 shared pathways including Transport of Mature mRNA derived from an Intron-Containing Transcript, mRNA 3'-end processing. SARNP 3 shared pathwaysTransport of Mature mRNA derived from an Intron-Containing Transcript, mRNA 3'-end processing, RNA Polymerase II Transcription Termination Related via 3 shared pathways including Transport of Mature mRNA derived from an Intron-Containing Transcript, mRNA 3'-end processing.
Kawasaki disease Linked via 1 of 5 related genesSARNP