Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	84787
Gene name	Lysine methyltransferase 5C
Gene symbol	KMT5C
Synonyms (NCBI Gene)	SUV420H2Suv4-20h2
Chromosome	19
Chromosome location	19q13.42
Summary	SUV420H2 and the related enzyme SUV420H1 (MIM 610881) function as histone methyltransferases that specifically trimethylate nucleosomal histone H4 (see MIM 602822) on lysine-20 (K20) (Schotta et al., 2004 [PubMed 15145825]).[supplied by OMIM, Dec 2009]

miRTarBase ID	miRNA	Experiments	Reference
MIRT737220	hsa-miR-29a-3p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)ImmunofluorescenceqRT-PCRIn situ hybridizationFlow cytometry	32904604

32 Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000779	Component	Condensed chromosome, centromeric region	IEA
GO:0000792	Component	Heterochromatin	IDA	19486527
GO:0003682	Function	Chromatin binding	IDA	28114273
GO:0003682	Function	Chromatin binding	IEA
GO:0005515	Function	Protein binding	IPI	19486527, 24981860
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005721	Component	Pericentric heterochromatin	IDA	19486527
GO:0006281	Process	DNA repair	IEA
GO:0006281	Process	DNA repair	IMP	28114273
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0008168	Function	Methyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032259	Process	Methylation	IEA
GO:0042393	Function	Histone binding	IEA
GO:0042799	Function	Histone H4K20 methyltransferase activity	IBA
GO:0042799	Function	Histone H4K20 methyltransferase activity	IDA	24049080, 24396869
GO:0042799	Function	Histone H4K20 methyltransferase activity	IEA
GO:0042799	Function	Histone H4K20 methyltransferase activity	IMP	28114273
GO:0045830	Process	Positive regulation of isotype switching	IEA
GO:0045830	Process	Positive regulation of isotype switching	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0140939	Function	Histone H4 methyltransferase activity	TAS
GO:0140941	Function	Histone H4K20me methyltransferase activity	IEA
GO:0140944	Function	Histone H4K20 monomethyltransferase activity	IEA
GO:1904047	Function	S-adenosyl-L-methionine binding	IDA	24049080
GO:2001034	Process	Positive regulation of double-strand break repair via nonhomologous end joining	IEA
GO:2001034	Process	Positive regulation of double-strand break repair via nonhomologous end joining	IMP	28114273

MIM	HGNC	e!Ensembl
613198	28405	ENSG00000133247

Q86Y97

Protein name

Histone-lysine N-methyltransferase KMT5C (Lysine N-methyltransferase 5C) (Lysine-specific methyltransferase 5C) (Suppressor of variegation 4-20 homolog 2) (Su(var)4-20 homolog 2) (Suv4-20h2) ([histone H4]-N-methyl-L-lysine20 N-methyltransferase KMT5B) (EC

Protein function

Histone methyltransferase that specifically methylates monomethylated 'Lys-20' (H4K20me1) and dimethylated 'Lys-20' (H4K20me2) of histone H4 to produce respectively dimethylated 'Lys-20' (H4K20me2) and trimethylated 'Lys-20' (H4K20me3) and thus

PDB

3RQ4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00856	SET	44 → 218	SET domain	Family

Sequence

MGPDRVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPPLRRQQHLRSALETFLRQRD
LEAAYRALTLGGWTARYFQSRGPRQEAALKTHVYRYLRAFLPESGFTILPCTRYSMETNG
AKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAF
INHDCKPNCKFVPADGNAACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECHTCERKGEG
AFRTRPREPALPPRPLDKYQLRETKRRLQQGLDSGSRQGLLGPRACVHPSPLRRDPFCAA
CQPLRLPACSARPDTSPLWLQWLPQPQPRVRPRKRRRPRPRRAPVLSTHHAARVSLHRWG
GCGPHCRLRGEALVALGQPPHARWAPQQDWHWARRYGLPYVVRVDLRRLAPAPPATPAPA
GTPGPILIPKQALAFAPFSPPKRLRLVVSHGSIDLDVGGEEL

Sequence length

462

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Lysine degradation	PKMTs methylate histone lysines
Metabolic pathways

KMT5C (lysine methyltransferase 5C)

Bookmark This Gene