KLC4 (kinesin light chain 4)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 89953
• Gene name: Kinesin light chain 4
• Gene symbol: KLC4
• Synonyms (NCBI Gene): CONDRHN, KNSL8, bA387M24.3
• Chromosome: 6
• Chromosome location: 6p21.1

miRNA Show/Hide all (115)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018861	hsa-miR-335-5p	Microarray	18185580
MIRT035911	hsa-miR-1180-3p	CLASH	23622248
MIRT1095681	hsa-miR-15a	CLIP-seq
MIRT1095682	hsa-miR-15b	CLIP-seq
MIRT1095683	hsa-miR-16	CLIP-seq
MIRT1095684	hsa-miR-195	CLIP-seq
MIRT1095685	hsa-miR-214	CLIP-seq
MIRT1095686	hsa-miR-3182	CLIP-seq
MIRT1095687	hsa-miR-3616-3p	CLIP-seq
MIRT1095688	hsa-miR-3619-5p	CLIP-seq
MIRT1095689	hsa-miR-3921	CLIP-seq
MIRT1095690	hsa-miR-424	CLIP-seq
MIRT1095691	hsa-miR-4436b-3p	CLIP-seq
MIRT1095692	hsa-miR-4530	CLIP-seq
MIRT1095693	hsa-miR-4649-3p	CLIP-seq
MIRT1095694	hsa-miR-4653-5p	CLIP-seq
MIRT1095695	hsa-miR-4690-5p	CLIP-seq
MIRT1095696	hsa-miR-4721	CLIP-seq
MIRT1095697	hsa-miR-497	CLIP-seq
MIRT1095698	hsa-miR-761	CLIP-seq
MIRT2025705	hsa-miR-4260	CLIP-seq
MIRT2025706	hsa-miR-4324	CLIP-seq
MIRT2256889	hsa-miR-3144-5p	CLIP-seq
MIRT2256890	hsa-miR-711	CLIP-seq
MIRT2558294	hsa-miR-1208	CLIP-seq
MIRT2558295	hsa-miR-1224-3p	CLIP-seq
MIRT2558296	hsa-miR-1260	CLIP-seq
MIRT2558297	hsa-miR-1260b	CLIP-seq
MIRT2558298	hsa-miR-1280	CLIP-seq
MIRT2558299	hsa-miR-1294	CLIP-seq
MIRT1095681	hsa-miR-15a	CLIP-seq
MIRT1095682	hsa-miR-15b	CLIP-seq
MIRT1095683	hsa-miR-16	CLIP-seq
MIRT1095684	hsa-miR-195	CLIP-seq
MIRT2558300	hsa-miR-2110	CLIP-seq
MIRT1095685	hsa-miR-214	CLIP-seq
MIRT2558301	hsa-miR-3127-3p	CLIP-seq
MIRT1095686	hsa-miR-3182	CLIP-seq
MIRT2558302	hsa-miR-3189-3p	CLIP-seq
MIRT1095687	hsa-miR-3616-3p	CLIP-seq
MIRT1095688	hsa-miR-3619-5p	CLIP-seq
MIRT2558303	hsa-miR-3908	CLIP-seq
MIRT1095689	hsa-miR-3921	CLIP-seq
MIRT1095690	hsa-miR-424	CLIP-seq
MIRT2025705	hsa-miR-4260	CLIP-seq
MIRT2558304	hsa-miR-4271	CLIP-seq
MIRT2558305	hsa-miR-4316	CLIP-seq
MIRT2558306	hsa-miR-4420	CLIP-seq
MIRT1095691	hsa-miR-4436b-3p	CLIP-seq
MIRT1095692	hsa-miR-4530	CLIP-seq
MIRT1095693	hsa-miR-4649-3p	CLIP-seq
MIRT2558307	hsa-miR-4651	CLIP-seq
MIRT1095694	hsa-miR-4653-5p	CLIP-seq
MIRT2558308	hsa-miR-4677-3p	CLIP-seq
MIRT1095695	hsa-miR-4690-5p	CLIP-seq
MIRT1095696	hsa-miR-4721	CLIP-seq
MIRT2558309	hsa-miR-4725-3p	CLIP-seq
MIRT2558310	hsa-miR-4786-5p	CLIP-seq
MIRT2558311	hsa-miR-491-5p	CLIP-seq
MIRT1095697	hsa-miR-497	CLIP-seq
MIRT2558312	hsa-miR-548g	CLIP-seq
MIRT2558313	hsa-miR-608	CLIP-seq
MIRT2558314	hsa-miR-665	CLIP-seq
MIRT1095698	hsa-miR-761	CLIP-seq
MIRT2558315	hsa-miR-769-5p	CLIP-seq
MIRT2558294	hsa-miR-1208	CLIP-seq
MIRT2558295	hsa-miR-1224-3p	CLIP-seq
MIRT2558296	hsa-miR-1260	CLIP-seq
MIRT2558297	hsa-miR-1260b	CLIP-seq
MIRT2558298	hsa-miR-1280	CLIP-seq
MIRT2683531	hsa-miR-140-3p	CLIP-seq
MIRT1095681	hsa-miR-15a	CLIP-seq
MIRT1095682	hsa-miR-15b	CLIP-seq
MIRT1095683	hsa-miR-16	CLIP-seq
MIRT1095684	hsa-miR-195	CLIP-seq
MIRT2558300	hsa-miR-2110	CLIP-seq
MIRT1095685	hsa-miR-214	CLIP-seq
MIRT2683532	hsa-miR-2467-3p	CLIP-seq
MIRT2683533	hsa-miR-3125	CLIP-seq
MIRT2558301	hsa-miR-3127-3p	CLIP-seq
MIRT1095686	hsa-miR-3182	CLIP-seq
MIRT2558302	hsa-miR-3189-3p	CLIP-seq
MIRT1095687	hsa-miR-3616-3p	CLIP-seq
MIRT1095688	hsa-miR-3619-5p	CLIP-seq
MIRT2683534	hsa-miR-3678-3p	CLIP-seq
MIRT2558303	hsa-miR-3908	CLIP-seq
MIRT2683535	hsa-miR-3916	CLIP-seq
MIRT1095689	hsa-miR-3921	CLIP-seq
MIRT1095690	hsa-miR-424	CLIP-seq
MIRT2025705	hsa-miR-4260	CLIP-seq
MIRT2558304	hsa-miR-4271	CLIP-seq
MIRT2558306	hsa-miR-4420	CLIP-seq
MIRT1095691	hsa-miR-4436b-3p	CLIP-seq
MIRT1095692	hsa-miR-4530	CLIP-seq
MIRT1095693	hsa-miR-4649-3p	CLIP-seq
MIRT2558307	hsa-miR-4651	CLIP-seq
MIRT1095694	hsa-miR-4653-5p	CLIP-seq
MIRT1095695	hsa-miR-4690-5p	CLIP-seq
MIRT1095696	hsa-miR-4721	CLIP-seq
MIRT2558309	hsa-miR-4725-3p	CLIP-seq
MIRT2683536	hsa-miR-4751	CLIP-seq
MIRT2558310	hsa-miR-4786-5p	CLIP-seq
MIRT2558311	hsa-miR-491-5p	CLIP-seq
MIRT1095697	hsa-miR-497	CLIP-seq
MIRT2683537	hsa-miR-518d-5p	CLIP-seq
MIRT2683538	hsa-miR-519b-5p	CLIP-seq
MIRT2683539	hsa-miR-519c-5p	CLIP-seq
MIRT2683540	hsa-miR-520c-5p	CLIP-seq
MIRT2683541	hsa-miR-526a	CLIP-seq
MIRT2558312	hsa-miR-548g	CLIP-seq
MIRT2558313	hsa-miR-608	CLIP-seq
MIRT2558314	hsa-miR-665	CLIP-seq
MIRT1095698	hsa-miR-761	CLIP-seq
MIRT2558315	hsa-miR-769-5p	CLIP-seq
MIRT2683542	hsa-miR-877	CLIP-seq

Gene ontology (GO) Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 33961781, 35271311, 36217029, 36931259
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005871	Component	Kinesin complex	IEA
GO:0005874	Component	Microtubule	IEA
GO:0007018	Process	Microtubule-based movement	IBA
GO:0019894	Function	Kinesin binding	IBA

Other IDs

• MIM: 620909
• HGNC: 21624
• e!Ensembl: ENSG00000137171

Protein

• UniProt ID: Q9NSK0
• Protein name: Kinesin light chain 4 (KLC 4) (Kinesin-like protein 8)
• Protein function: Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport. The light chain may function in coupling of cargo to the heavy chain or in the modulation of its ATPase activity (By similarity). {ECO:00002
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13374	TPR_10	294 → 335		Repeat
  PF13374	TPR_10	465 → 496		Repeat
  PF13424	TPR_12	293 → 369		Repeat
  PF13424	TPR_12	335 → 409		Repeat
  PF13424	TPR_12	209 → 285		Repeat

• Sequence:

  MSGLVLGQRDEPAGHRLSQEEILGSTRLVSQGLEALRSEHQAVLQSLSQTIECLQQGGHE
  EGLVHEKARQLRRSMENIELGLSEAQVMLALASHLSTVESEKQKLRAQVRRLCQENQWLR
  DELAGTQQRLQRSEQAVAQLEEEKKHLEFLGQLRQYDEDGHTSEEKEGDATKDSLDDLFP
  NEEEEDPSNGLSRGQGATAAQQGGYEIPARLRTLHNLVIQYAAQGRYEVAVPLCKQALED
  LERTSGRGHPDVATMLNILALVYRDQNKYKEAAHLLNDALSIRESTLGPDHPAVAATLNN
  LAVLYGKRGKYKEAEPLCQRALEIREKVLGTNHPDVAKQLNNLALLCQNQGKYEAVERYY
  QRALAIYEGQLGPDNPNVARTKNNLASCYLKQGKYAEAETLYKEILTRAHVQEFGSVDDD
  HKPIWMHAEEREEMSKSRHHEGGTPYAEYGGWYKACKVSSPTVNTTLRNLGALYRRQGKL
  EAAETLEECALRSRRQGTDPISQTKVAELLGESDGRRTSQEGPGDSVKFEGGEDASVAVE
  WSGDGSGTLQRSGSLGKIRDVLRRSSELLVRKLQGTEPRPSSSNMKRAASLNYLNQPSAA
  PLQVSRGLSASTMDLSSSS

• Sequence length: 619

Pathways

KEGG Pathway	Reactome Pathway
Motor proteins	MHC class II antigen presentation
Alzheimer disease	RHO GTPases activate KTN1
Parkinson disease	COPI-dependent Golgi-to-ER retrograde traffic
Amyotrophic lateral sclerosis	Kinesins
Huntington disease
Prion disease
Pathways of neurodegeneration - multiple diseases
Salmonella infection

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
NEURODEGENERATION, EARLY-CHILDHOOD-ONSET, WITH RETINITIS PIGMENTOSA, SENSORINEURAL HEARING LOSS, AND DEMYELINATING PERIPHERAL NEUROPATHY	—	HPO	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (14)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Carcinoma of lung	Lung carcinoma	BEFREE	29717133		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31235251		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	31235251		★☆☆☆☆ Found in Text Mining only
Frontal bossing	Frontal bossing	CLINVAR_DG	30980518		★☆☆☆☆ Found in Text Mining only
Long narrow head	Dolichocephaly	CLINVAR_DG	30980518		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	32457423	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29717133		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29717133		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31235251		★☆☆☆☆ Found in Text Mining only
Miller-McKusick-Malvaux-Syndrome (3M Syndrome)	3M Syndrome	CLINVAR_DG	30980518		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29717133		★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	CLINVAR_DG	30980518		★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia	Spastic Paraplegia	BEFREE	26423925		★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia	Spastic Paraplegia	GENOMICS_ENGLAND_DG	26423925		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

KLC3 8 shared pathwaysMotor proteins, Parkinson disease, Prion disease, Salmonella infection, COPI-dependent Golgi-to-ER retrograde traffic, MHC class II antigen presentation, Kinesins, RHO GTPases activate KTN1 Related via 8 shared pathways including Motor proteins, Parkinson disease. KLC1 8 shared pathwaysMotor proteins, Parkinson disease, Prion disease, Salmonella infection, COPI-dependent Golgi-to-ER retrograde traffic, MHC class II antigen presentation, Kinesins, RHO GTPases activate KTN1 Related via 8 shared pathways including Motor proteins, Parkinson disease. KLC2 8 shared pathwaysMotor proteins, Parkinson disease, Prion disease, Salmonella infection, COPI-dependent Golgi-to-ER retrograde traffic, MHC class II antigen presentation, Kinesins, RHO GTPases activate KTN1 Related via 8 shared pathways including Motor proteins, Parkinson disease. KIF5A 8 shared pathwaysMotor proteins, Parkinson disease, Prion disease, Salmonella infection, COPI-dependent Golgi-to-ER retrograde traffic, MHC class II antigen presentation, Kinesins, RHO GTPases activate KTN1 Related via 8 shared pathways including Motor proteins, Parkinson disease. KIF5B 8 shared pathwaysMotor proteins, Parkinson disease, Prion disease, Salmonella infection, COPI-dependent Golgi-to-ER retrograde traffic, MHC class II antigen presentation, Kinesins, RHO GTPases activate KTN1 Related via 8 shared pathways including Motor proteins, Parkinson disease.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
KLC3	0	[]	8	["Motor proteins","Parkinson disease","Prion disease","Salmonella infection","COPI-dependent Golgi-to-ER retrograde traffic","MHC class II antigen presentation","Kinesins","RHO GTPases activate KTN1"]	0	[]
KLC1	0	[]	8	["Motor proteins","Parkinson disease","Prion disease","Salmonella infection","COPI-dependent Golgi-to-ER retrograde traffic","MHC class II antigen presentation","Kinesins","RHO GTPases activate KTN1"]	0	[]
KLC2	0	[]	8	["Motor proteins","Parkinson disease","Prion disease","Salmonella infection","COPI-dependent Golgi-to-ER retrograde traffic","MHC class II antigen presentation","Kinesins","RHO GTPases activate KTN1"]	0	[]
KIF5A	0	[]	8	["Motor proteins","Parkinson disease","Prion disease","Salmonella infection","COPI-dependent Golgi-to-ER retrograde traffic","MHC class II antigen presentation","Kinesins","RHO GTPases activate KTN1"]	0	[]
KIF5B	0	[]	8	["Motor proteins","Parkinson disease","Prion disease","Salmonella infection","COPI-dependent Golgi-to-ER retrograde traffic","MHC class II antigen presentation","Kinesins","RHO GTPases activate KTN1"]	0	[]

Diseases Linked via Similar Genes

Schizophrenia Linked via 3 of 5 related genesKLC1, KIF5A, KIF5B Alzheimer disease Linked via 2 of 5 related genesKLC3, KLC1 Attention deficit hyperactivity disorder Linked via 2 of 5 related genesKLC1, KIF5B Bipolar disorder Linked via 2 of 5 related genesKLC1, KIF5B Insomnia Linked via 2 of 5 related genesKLC1, KIF5A

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Schizophrenia	3	["KLC1","KIF5A","KIF5B"]
Alzheimer disease	2	["KLC3","KLC1"]
Attention deficit hyperactivity disorder	2	["KLC1","KIF5B"]
Bipolar disorder	2	["KLC1","KIF5B"]
Insomnia	2	["KLC1","KIF5A"]