KIR2DL4 (killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 4)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 3805
Gene name Killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 4
Gene symbol KIR2DL4
Synonyms (NCBI Gene)
CD158DG9PKIR-103ASKIR-2DL4KIR103KIR103AS
Chromosome 19
Chromosome location 19q13.42
Summary Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the
miRNA miRNA information provided by mirtarbase database.
5
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT2256792 hsa-miR-4426 CLIP-seq
MIRT2256793 hsa-miR-4534 CLIP-seq
MIRT2256794 hsa-miR-4647 CLIP-seq
MIRT2256795 hsa-miR-4662b CLIP-seq
MIRT2256796 hsa-miR-4765 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17 Show/Hide all (17)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002729 Process Positive regulation of natural killer cell cytokine production IDA 16366734, 19304799, 23184984
GO:0002764 Process Immune response-regulating signaling pathway IBA
GO:0004888 Function Transmembrane signaling receptor activity TAS 8946682
GO:0005515 Function Protein binding IPI 16366734, 18604210, 25416956, 32296183, 34158475
GO:0005768 Component Endosome IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
604945 6332 ENSG00000189013
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q99706
Protein name Killer cell immunoglobulin-like receptor 2DL4 (CD158 antigen-like family member D) (G9P) (Killer cell inhibitory receptor 103AS) (KIR-103AS) (MHC class I NK cell receptor KIR103AS) (CD antigen CD158d)
Protein function Receptor for non-classical major histocompatibility class Ib HLA-G molecules. Recognizes HLA-G in complex with B2M/beta-2 microglobulin and a nonamer self-peptide (peptide-bound HLA-G-B2M). In decidual NK cells, binds peptide-bound HLA-G-B2M com
PDB 3WYR
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00047 ig 34 → 112 Immunoglobulin domain Domain
PF00047 ig 129 → 209 Immunoglobulin domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in decidual NK cells and innate lymphoid cell type I (ILC1) (PubMed:29262349). Expressed in a subset of peripheral NK cells (PubMed:19304799). {ECO:0000269|PubMed:19304799, ECO:0000269|PubMed:29262349}.
Sequence 
MSMSPTVIILACLGFFLDQSVWAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIF
TLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVT
GLYEKPSLTARPGPTVRAGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQA
DFPLGPATHGETYRCFGSFHGSPYEWSDPSDPLPVSVTGNPSSSWPSPTEPSFKTGIARH
LHAVIRYSVAIILFTILPFFLLHRWCSKKKDAAVMNQEPAGHRTVNREDSDEQDPQEVTY
AQLDHCIFTQRKITGPSQRSKRPSTDTSVCIELPNAEPRALSPAHEHHSQALMGSSRETT
ALSQTQLASSNVPAAGI
Sequence length 377
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Cellular senescence Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Antigen processing and presentation  
Natural killer cell mediated cytotoxicity  
Sort by:
KIR2DS2 3 shared pathwaysAntigen processing and presentation, Natural killer cell mediated cytotoxicity, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 3 shared pathways including Antigen processing and presentation, Natural killer cell mediated cytotoxicity. KIR2DL1 3 shared pathwaysAntigen processing and presentation, Natural killer cell mediated cytotoxicity, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 3 shared pathways including Antigen processing and presentation, Natural killer cell mediated cytotoxicity. KIR2DL2 3 shared pathwaysAntigen processing and presentation, Natural killer cell mediated cytotoxicity, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 3 shared pathways including Antigen processing and presentation, Natural killer cell mediated cytotoxicity. KIR2DL3 3 shared pathwaysAntigen processing and presentation, Natural killer cell mediated cytotoxicity, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 3 shared pathways including Antigen processing and presentation, Natural killer cell mediated cytotoxicity. KIR2DS1 3 shared pathwaysAntigen processing and presentation, Natural killer cell mediated cytotoxicity, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 3 shared pathways including Antigen processing and presentation, Natural killer cell mediated cytotoxicity.
Keratoconus Linked via 1 of 5 related genesKIR2DL1 Autoimmune hepatitis Linked via 1 of 5 related genesKIR2DL2