Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	57608
Gene name	Junctional cadherin 5 associated
Gene symbol	JCAD
Synonyms (NCBI Gene)	KIAA1462
Chromosome	10
Chromosome location	10p11.23
Summary	This gene encodes an endothelial cell-to-cell junction protein. Naturally occurring mutations in this gene are associated with coronary artery disease, late onset alzheimer disease, and emphysema distribution. [provided by RefSeq, Mar 2017]

48 Show/Hide all (48)

miRTarBase ID	miRNA	Experiments	Reference
MIRT656933	hsa-miR-181c-3p	HITS-CLIP	23824327
MIRT656932	hsa-miR-1250-3p	HITS-CLIP	23824327
MIRT656931	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT656930	hsa-miR-623	HITS-CLIP	23824327
MIRT656929	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT656928	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT656927	hsa-miR-548aw	HITS-CLIP	23824327
MIRT656926	hsa-miR-518a-5p	HITS-CLIP	23824327
MIRT656925	hsa-miR-527	HITS-CLIP	23824327
MIRT656924	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT656923	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT656922	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT656921	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT656920	hsa-miR-507	HITS-CLIP	23824327
MIRT656919	hsa-miR-557	HITS-CLIP	23824327
MIRT656918	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT230396	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT544065	hsa-miR-6882-5p	PAR-CLIP	21572407
MIRT027286	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT544064	hsa-miR-144-3p	PAR-CLIP	21572407
MIRT544063	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT544062	hsa-miR-6504-3p	PAR-CLIP	21572407
MIRT544061	hsa-miR-873-5p	PAR-CLIP	21572407
MIRT544060	hsa-miR-4775	PAR-CLIP	21572407
MIRT027286	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT544059	hsa-miR-582-5p	PAR-CLIP	21572407
MIRT544058	hsa-miR-30a-3p	PAR-CLIP	21572407
MIRT544057	hsa-miR-30d-3p	PAR-CLIP	21572407
MIRT544056	hsa-miR-30e-3p	PAR-CLIP	21572407
MIRT544055	hsa-miR-335-3p	PAR-CLIP	21572407
MIRT230396	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT544065	hsa-miR-6882-5p	PAR-CLIP	21572407
MIRT027286	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT544064	hsa-miR-144-3p	PAR-CLIP	21572407
MIRT544063	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT544062	hsa-miR-6504-3p	PAR-CLIP	21572407
MIRT544061	hsa-miR-873-5p	PAR-CLIP	21572407
MIRT544060	hsa-miR-4775	PAR-CLIP	21572407
MIRT027286	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT544059	hsa-miR-582-5p	PAR-CLIP	21572407
MIRT544058	hsa-miR-30a-3p	PAR-CLIP	21572407
MIRT544057	hsa-miR-30d-3p	PAR-CLIP	21572407
MIRT544056	hsa-miR-30e-3p	PAR-CLIP	21572407
MIRT544055	hsa-miR-335-3p	PAR-CLIP	21572407
MIRT230396	hsa-miR-590-3p	PAR-CLIP	23446348
MIRT511330	hsa-miR-4740-3p	PAR-CLIP	23446348
MIRT230396	hsa-miR-590-3p	PAR-CLIP	23446348
MIRT511330	hsa-miR-4740-3p	PAR-CLIP	23446348

16 Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005911	Component	Cell-cell junction	IEA
GO:0005912	Component	Adherens junction	IBA
GO:0005912	Component	Adherens junction	IDA	28705794
GO:0005912	Component	Adherens junction	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0030054	Component	Cell junction	IEA
GO:0032587	Component	Ruffle membrane	IBA
GO:0032587	Component	Ruffle membrane	IDA	28705794
GO:0043410	Process	Positive regulation of MAPK cascade	IMP	28705794
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	28705794
GO:0070161	Component	Anchoring junction	IEA
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IMP	28705794
GO:1900748	Process	Positive regulation of vascular endothelial growth factor signaling pathway	IMP	28705794
GO:1903589	Process	Positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IBA
GO:1903589	Process	Positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IMP	28705794
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IEA

MIM	HGNC	e!Ensembl
614398	29283	ENSG00000165757

Q9P266

Protein name

Junctional cadherin 5-associated protein (Junctional protein associated with coronary artery disease) (JCAD)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15351	JCAD	1 → 1348	Junctional protein associated with coronary artery disease	Family

Sequence

MYSVEDLLISHGYKLSRDPPASREDNPKGRQAARTGTRAGQGLQNGHEDGPAALAHRKTS
AGKGHVSDSESRRSTPRGHGEPQSTSASRTSEAGFCNQPPSAWSSHPPTGNDQAYRRRGR
QEARSQKPREHENLEARGMAQAHSLPVHVREGPWEVGGRSEHVMKKPVWEEELRMSGPAK
WQNVSLESWNQPRKLGRQMSDGDGERLFQDLYPFIQGEHVLNSQNKGKSRSLPRVLSPES
LSCTEIPIPLNERHSPKMPPYPPTCAPNLDSTRNSEKSGCSAPFPRPKFGRPLKPPSYSS
HQQSRGGADSSDSQDSQQMDAYVPRHELCLSDPGLEPPVYVPPPSYRSPPQNIPNPYLED
TVPINVCGGHSQQQSPTEKAGASGQPPSGPPGTGNEYGVSPRLPQGLPAHPRPVTAYDGF
VQYIPFDDPRLRHFKLAQPQGFCEDIKLDDKSYNSSPVTAQEPAHGGMQPDGAIWNPQSL
IPPSGDERGLVLADSSPRWLWGQPPGDGENSGLPNQRDRCVARGQWPDVRGSQHGHTGRQ
VSSPYSQGESTCETQTKLKKFQTGTRTKKSSKKKMNETIFCLVSIPVKSESHLPDRDMDN
NDLKPSADQKNGSDKSPALQEQSLLSMSSTDLELQALTGSMGGRTEFQKQDLGEPEEDRQ
TNDLSFIHLTKHRELKHSGSWPGHRYRDQQTQTSFSEEPQSSQLLPGAKLGGPSRAALSP
KCSDPAASEAQTHTAFPTGDHKQRPSARNLKGHRSLSPSSNSAFSRTSLSVDQAPTPKAG
RSQPCVDVHGLGAHPGPKREVVKGEPTGPCNSKQLFGQFLLKPVSRRPWDLISQLESFNK
ELQEEEESSSSSSSSSSSSEESEAEPQQENRAHCRQEDVGFRGNSPEMRVEPQPRMWVPE
SPVCRSGRGESKSESWSEELQPGHPRAWPPSPGRFRVEEGGGAPFCSADGSTSAEKRHLE
VSNGMDELAGSPFPVTRMSSRSSDAKPLPASYPAEPREPQESPKITSAFSSVKPSEAVPR
KFDSGGERGAGLPLSLSNKNRGLSAPDLRSVGLTPGQEQGASELEGSLGEASTIEIPPGE
SLQARAARILGIEVAVESLLPGIRRAGQNQPAEPDASACTPESPQEELLSRPAPADVPRV
STDAFYGRRKCGWTKSPLFVGDRDSARRAPQAFEHSDVDGVVTSTDPVPEPEPSPLESKF
FEQKDVETKPPFRSTLFHFVERTPSVAGSEKRLRSPSKVIESLQEKLASPPRRADPDRLM
RMKEVSSVSRMRVLSFRNADSQEDAEELKATTRGQAGLPGGLVSPGSGDRAQRLGHSLSV
SKDSISREEKEHPAAQKEKSMDQDFWCPDSYDPSRVERV

Sequence length

1359

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (24)
ALZHEIMER DISEASE	—	GWAS catalog	26830138	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	34446935	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	37069358	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CIRRHOSIS OF LIVER	—	GWAS catalog	20708005	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD, GWAS catalog CTD, GWAS catalog	21088011, 21378988, 21378988, 34961328, 26343387, 28714975, 29212778, 30104761, 32469254, 33020668, 35285134, 36474045, 39024449, 39537608	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ATHEROSCLEROSIS	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULITIS	—	GWAS catalog	37196047	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASE	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	35835914	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LARGE ARTERY STROKE	—	GWAS catalog	36180795	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	30219690	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL OR BEHAVIOURAL DISORDER	—	GWAS catalog	21041247	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	23793025	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE WITH AURA	—	GWAS catalog	23793025	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	26343387, 33532862, 38072966	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	30104761, 39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	20708005	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSTRUCTIVE SLEEP APNEA	—	GWAS catalog	35819321	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFT	—	GWAS catalog	22419666	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATITIS	—	GWAS catalog	23143602	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	34446935	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (29)
Alzheimer Disease	Alzheimer disease	Pubtator	24349219	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	24349219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29794114, 31539914, 31584065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	29794114	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29794114, 31539914, 31584065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	24349219	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	24349219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	CTD_human_DG	21378988		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	21884682, 24349219, 28705794, 31539914, 31584065		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	21088011, 21884682, 24349219, 28705794, 29794114, 31539914, 31584065		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	CTD_human_DG	21378988		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASDB_DG	23202125		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	24349219, 29794114, 32685059	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	26343387, 28714975, 29212778, 30104761		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	21088011, 21378988		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	GWASCAT_DG	21088011, 21378988		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	21884682, 24349219, 28705794, 31539914, 31584065		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Stenosis	Coronary stenosis	Pubtator	32685059	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	27669027	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28775168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28775168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	GWASCAT_DG	26343387		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	30678728		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	28775168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	28775168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	16810331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23774303	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	27669027	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	29794114	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
MRPS6	2	["Ischemic heart disease","Heart disease"]	[]	5	["Disgenet (Ischemic heart disease)","Disgenet (Coronary artery disease)","CTD (Coronary artery disease)","GWAS catalog (Heart disease)","GWAS catalog (Myocardial ischemia)"]
TCF21	3	["Ischemic heart disease","Heart disease","Large artery stroke"]	[]	6	["Disgenet (Ischemic heart disease)","Disgenet (Coronary artery disease)","CTD (Coronary artery disease)","GWAS catalog (Heart disease)","GWAS catalog (Large artery stroke)","GWAS catalog (Myocardial ischemia)"]
ZC3HC1	3	["Ischemic heart disease","Heart disease","Large artery stroke"]	[]	6	["Disgenet (Ischemic heart disease)","Disgenet (Coronary artery disease)","CTD (Coronary artery disease)","GWAS catalog (Heart disease)","GWAS catalog (Large artery stroke)","GWAS catalog (Myocardial ischemia)"]
HHIPL1	2	["Ischemic heart disease","Heart disease"]	[]	5	["Disgenet (Ischemic heart disease)","Disgenet (Coronary artery disease)","CTD (Coronary artery disease)","GWAS catalog (Heart disease)","GWAS catalog (Myocardial ischemia)"]
PLPP3	3	["Ischemic heart disease","Heart disease","Large artery stroke"]	[]	6	["Disgenet (Ischemic heart disease)","Disgenet (Coronary artery disease)","CTD (Coronary artery disease)","GWAS catalog (Heart disease)","GWAS catalog (Large artery stroke)","GWAS catalog (Myocardial ischemia)"]

JCAD (junctional cadherin 5 associated)

Bookmark This Gene