HHIPL1 (HHIP like 1)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 84439
• Gene name: HHIP like 1
• Gene symbol: HHIPL1
• Synonyms (NCBI Gene): KIAA1822, UNQ9245
• Chromosome: 14
• Chromosome location: 14q32.2
• Summary: This gene encodes a protein that belongs to the glucose/sorbosone dehydrogenase family. The encoded protein also contains a domain that binds folate and reduced folic acid derivatives. [provided by RefSeq, Jul 2016]

miRNA Show/Hide all (139)

miRTarBase ID	miRNA	Experiments	Reference
MIRT641073	hsa-miR-362-5p	HITS-CLIP	23824327
MIRT641072	hsa-miR-500b-5p	HITS-CLIP	23824327
MIRT641071	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT641070	hsa-miR-885-5p	HITS-CLIP	23824327
MIRT647356	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT641069	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT647354	hsa-miR-891b	HITS-CLIP	23824327
MIRT647353	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT647352	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT647351	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT641067	hsa-miR-2681-5p	HITS-CLIP	23824327
MIRT641074	hsa-miR-5003-3p	HITS-CLIP	23824327
MIRT641073	hsa-miR-362-5p	HITS-CLIP	23824327
MIRT641072	hsa-miR-500b-5p	HITS-CLIP	23824327
MIRT641071	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT641070	hsa-miR-885-5p	HITS-CLIP	23824327
MIRT647356	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT641069	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT641068	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT647355	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT647354	hsa-miR-891b	HITS-CLIP	23824327
MIRT647353	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT647352	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT647351	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT641067	hsa-miR-2681-5p	HITS-CLIP	23824327
MIRT641074	hsa-miR-5003-3p	HITS-CLIP	23824327
MIRT641073	hsa-miR-362-5p	HITS-CLIP	23824327
MIRT641072	hsa-miR-500b-5p	HITS-CLIP	23824327
MIRT641071	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT641070	hsa-miR-885-5p	HITS-CLIP	23824327
MIRT641069	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT641068	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT641067	hsa-miR-2681-5p	HITS-CLIP	23824327
MIRT475700	hsa-miR-30b-5p	PAR-CLIP	23592263
MIRT475699	hsa-miR-30e-5p	PAR-CLIP	23592263
MIRT475698	hsa-miR-30a-5p	PAR-CLIP	23592263
MIRT475697	hsa-miR-30c-5p	PAR-CLIP	23592263
MIRT475696	hsa-miR-30d-5p	PAR-CLIP	23592263
MIRT475695	hsa-miR-4796-3p	PAR-CLIP	23592263
MIRT475693	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT475694	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT475692	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT475691	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT475690	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT475689	hsa-miR-940	PAR-CLIP	23592263
MIRT475688	hsa-miR-4756-3p	PAR-CLIP	23592263
MIRT475687	hsa-miR-1827	PAR-CLIP	23592263
MIRT475686	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT475685	hsa-miR-3612	PAR-CLIP	23592263
MIRT475684	hsa-miR-650	PAR-CLIP	23592263
MIRT475683	hsa-miR-6801-5p	PAR-CLIP	23592263
MIRT475681	hsa-miR-3650	PAR-CLIP	23592263
MIRT641073	hsa-miR-362-5p	HITS-CLIP	23824327
MIRT641072	hsa-miR-500b-5p	HITS-CLIP	23824327
MIRT641071	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT641070	hsa-miR-885-5p	HITS-CLIP	23824327
MIRT647356	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT641069	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT647354	hsa-miR-891b	HITS-CLIP	23824327
MIRT647353	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT647352	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT647351	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT641067	hsa-miR-2681-5p	HITS-CLIP	23824327
MIRT641074	hsa-miR-5003-3p	HITS-CLIP	23824327
MIRT641073	hsa-miR-362-5p	HITS-CLIP	23824327
MIRT641072	hsa-miR-500b-5p	HITS-CLIP	23824327
MIRT641071	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT641070	hsa-miR-885-5p	HITS-CLIP	23824327
MIRT647356	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT641069	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT641068	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT647355	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT647354	hsa-miR-891b	HITS-CLIP	23824327
MIRT647353	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT647352	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT647351	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT641067	hsa-miR-2681-5p	HITS-CLIP	23824327
MIRT641074	hsa-miR-5003-3p	HITS-CLIP	23824327
MIRT641073	hsa-miR-362-5p	HITS-CLIP	23824327
MIRT641072	hsa-miR-500b-5p	HITS-CLIP	23824327
MIRT641071	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT641070	hsa-miR-885-5p	HITS-CLIP	23824327
MIRT641069	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT641068	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT641067	hsa-miR-2681-5p	HITS-CLIP	23824327
MIRT475700	hsa-miR-30b-5p	PAR-CLIP	23592263
MIRT475699	hsa-miR-30e-5p	PAR-CLIP	23592263
MIRT475698	hsa-miR-30a-5p	PAR-CLIP	23592263
MIRT475697	hsa-miR-30c-5p	PAR-CLIP	23592263
MIRT475696	hsa-miR-30d-5p	PAR-CLIP	23592263
MIRT475695	hsa-miR-4796-3p	PAR-CLIP	23592263
MIRT475693	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT475694	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT475692	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT475691	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT475690	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT475689	hsa-miR-940	PAR-CLIP	23592263
MIRT475688	hsa-miR-4756-3p	PAR-CLIP	23592263
MIRT475687	hsa-miR-1827	PAR-CLIP	23592263
MIRT475686	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT475685	hsa-miR-3612	PAR-CLIP	23592263
MIRT475684	hsa-miR-650	PAR-CLIP	23592263
MIRT475683	hsa-miR-6801-5p	PAR-CLIP	23592263
MIRT475681	hsa-miR-3650	PAR-CLIP	23592263
MIRT1045016	hsa-miR-149	CLIP-seq
MIRT1045017	hsa-miR-193a-5p	CLIP-seq
MIRT1045018	hsa-miR-1972	CLIP-seq
MIRT1045019	hsa-miR-1976	CLIP-seq
MIRT1045020	hsa-miR-3189-3p	CLIP-seq
MIRT1045021	hsa-miR-3665	CLIP-seq
MIRT1045022	hsa-miR-4268	CLIP-seq
MIRT1045023	hsa-miR-4312	CLIP-seq
MIRT1045024	hsa-miR-4468	CLIP-seq
MIRT1045025	hsa-miR-4650-5p	CLIP-seq
MIRT1045026	hsa-miR-4691-5p	CLIP-seq
MIRT1045027	hsa-miR-4717-5p	CLIP-seq
MIRT1045028	hsa-miR-4722-3p	CLIP-seq
MIRT1045029	hsa-miR-483-3p	CLIP-seq
MIRT1045030	hsa-miR-550a	CLIP-seq
MIRT1045031	hsa-miR-603	CLIP-seq
MIRT1045032	hsa-miR-764	CLIP-seq
MIRT2242245	hsa-miR-4726-3p	CLIP-seq
MIRT2242246	hsa-miR-665	CLIP-seq
MIRT2242247	hsa-miR-124	CLIP-seq
MIRT2242248	hsa-miR-3160-3p	CLIP-seq
MIRT2242249	hsa-miR-3202	CLIP-seq
MIRT2242250	hsa-miR-3652	CLIP-seq
MIRT2242251	hsa-miR-3915	CLIP-seq
MIRT2242252	hsa-miR-3928	CLIP-seq
MIRT2242253	hsa-miR-4430	CLIP-seq
MIRT2242254	hsa-miR-4446-3p	CLIP-seq
MIRT2242255	hsa-miR-4476	CLIP-seq
MIRT2242256	hsa-miR-4492	CLIP-seq
MIRT2242257	hsa-miR-4493	CLIP-seq
MIRT2242258	hsa-miR-4498	CLIP-seq
MIRT2242259	hsa-miR-4520a-3p	CLIP-seq
MIRT2242260	hsa-miR-4638-3p	CLIP-seq
MIRT2242261	hsa-miR-506	CLIP-seq
MIRT2242262	hsa-miR-762	CLIP-seq

Gene ontology (GO) Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003674	Function	Molecular_function	ND
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005575	Component	Cellular_component	ND
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0007224	Process	Smoothened signaling pathway	IEA
GO:0008150	Process	Biological_process	ND
GO:0008283	Process	Cell population proliferation	IEA
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IEA
GO:0060840	Process	Artery development	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q96JK4
• Protein name: HHIP-like protein 1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00530	SRCR	679 → 776	Scavenger receptor cysteine-rich domain	Domain
  PF03024	Folate_rec	22 → 183	Folate receptor family	Domain
  PF07995	GSDH	193 → 527	Glucose / Sorbosone dehydrogenase	Domain

• Sequence:

  MARARAGALLALWVLGAAAHPQCLDFRPPFRPTQPLRLCAQYSDFGCCDEGRDAELTRRF
  WALASRVDAAEWAACAGYARDLLCQECSPYAAHLYDAEDPFTPLRTVPGLCQDYCLDMWH
  KCRGLFRHLSTDQELWALEGNLARFCRYLSLDDTDYCFPYLLVNKNLNSNLGHVVADAKG
  CLQLCLEEVANGLRNPVAMVHARDGTHRFFVAEQVGLVWAYLPDRSRLGKPFLNISRVVL
  TSPWEGDERGFLGIAFHPSFQHNRRLYVYYSVGIRSSEWIRISEFRVSEDDENAVDHSSE
  RIILEVKEPASNHNGGQLLFGDDGYLYIFTGDGGMAGDPFGTFGNAQNKSALLGKVLRID
  VDRKERGLPYGIPPDNPFVGDPAAQPEVYALGVRNMWRCSFDRGDPSSGTGRGRLFCGDV
  GQNKFEEVDVVERGGNYGWRAREGFECYDRSLCANTSLNDLLPIFAYPHTVGKSVTGGYV
  YRGCEYPNLNGLYIFGDFMSGRLMSLQENPGTGQWQYSEICMGHGQTCEFPGLINNYYPY
  IISFGEDEAGELYFMSTGEPSATAPRGVVYKIIDASRRAPPGKCQIQPAQVKIRSRLIPF
  VPKEKFIPKTRSTPRPTARAPTRAPRRGRPTAAPPAPTPRPARPTQQPGSRRGGGRRRGR
  LNSASRAFRDGEVRLVRPAGLSSGSGRVEVFVGGRWGTVCDDSWNISGAAVVCRQLGFAY
  AVRAVKRAEFGQGGSLPILLDDVRCAGWERNLLECQHNGVGTHNCEHDEDAGVVCSHQNP
  DL

• Sequence length: 782

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (13)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
CARDIOVASCULAR DISEASE	—	GWAS catalog	37947095	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARPAL TUNNEL SYNDROME	—	GWAS catalog	35332129	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD, GWAS catalog CTD, GWAS catalog	21378990, 26343387, 28714975, 29212778, 32469254, 33020668, 35285134, 36474045, 39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ATHEROSCLEROSIS	—	GWAS catalog	32589924, 39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	28604730	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	26343387, 33532862, 34594039, 38072966	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	35893037	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (15)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenoma	Adenoma	BEFREE	23045325		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	24573017, 31163988		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	24573017, 31163988		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29655894		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	CTD_human_DG	21378990		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	31163988		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	CTD_human_DG	21378990		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASDB_DG	23202125		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	26343387, 28714975, 29212778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	31163988		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE, AUTOSOMAL DOMINANT, 1	Coronary artery disease	GWASDB_DG	23202125		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	21378990		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	GWASCAT_DG	21378990		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	31163988		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	29655894		★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes

Sort by: Blended Diseases Pathways Evidence source

MRPS6 2 shared diseasesIschemic heart disease, Heart disease 5 shared evidence sourcesDisgenet (Ischemic heart disease), Disgenet (Coronary artery disease), CTD (Coronary artery disease), GWAS catalog (Heart disease), GWAS catalog (Myocardial ischemia) Related via 2 shared diseases including Ischemic heart disease, Heart disease — evidence mostly Disgenet. MKX 2 shared diseasesCarpal tunnel syndrome, Heart disease 2 shared evidence sourcesGWAS catalog (Carpal tunnel syndrome), GWAS catalog (Heart disease) Related via 2 shared diseases including Carpal tunnel syndrome, Heart disease — evidence mostly GWAS catalog. ICA1L 2 shared diseasesIschemic heart disease, Heart disease 5 shared evidence sourcesDisgenet (Ischemic heart disease), Disgenet (Coronary artery disease), CTD (Coronary artery disease), GWAS catalog (Heart disease), GWAS catalog (Myocardial ischemia) Related via 2 shared diseases including Ischemic heart disease, Heart disease — evidence mostly Disgenet. PROCR 2 shared diseasesIschemic heart disease, Heart disease 4 shared evidence sourcesDisgenet (Ischemic heart disease), Disgenet (Coronary artery disease), CTD (Coronary artery disease), GWAS catalog (Heart disease) Related via 2 shared diseases including Ischemic heart disease, Heart disease — evidence mostly Disgenet. TCF21 2 shared diseasesIschemic heart disease, Heart disease 5 shared evidence sourcesDisgenet (Ischemic heart disease), Disgenet (Coronary artery disease), CTD (Coronary artery disease), GWAS catalog (Heart disease), GWAS catalog (Myocardial ischemia) Related via 2 shared diseases including Ischemic heart disease, Heart disease — evidence mostly Disgenet.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
MRPS6	2	["Ischemic heart disease","Heart disease"]	0	[]	5	["Disgenet (Ischemic heart disease)","Disgenet (Coronary artery disease)","CTD (Coronary artery disease)","GWAS catalog (Heart disease)","GWAS catalog (Myocardial ischemia)"]
MKX	2	["Carpal tunnel syndrome","Heart disease"]	0	[]	2	["GWAS catalog (Carpal tunnel syndrome)","GWAS catalog (Heart disease)"]
ICA1L	2	["Ischemic heart disease","Heart disease"]	0	[]	5	["Disgenet (Ischemic heart disease)","Disgenet (Coronary artery disease)","CTD (Coronary artery disease)","GWAS catalog (Heart disease)","GWAS catalog (Myocardial ischemia)"]
PROCR	2	["Ischemic heart disease","Heart disease"]	0	[]	4	["Disgenet (Ischemic heart disease)","Disgenet (Coronary artery disease)","CTD (Coronary artery disease)","GWAS catalog (Heart disease)"]
TCF21	2	["Ischemic heart disease","Heart disease"]	0	[]	5	["Disgenet (Ischemic heart disease)","Disgenet (Coronary artery disease)","CTD (Coronary artery disease)","GWAS catalog (Heart disease)","GWAS catalog (Myocardial ischemia)"]

Diseases Linked via Similar Genes

Obstructive pulmonary disease Linked via 3 of 5 related genesMRPS6, ICA1L, PROCR Migraine Linked via 3 of 5 related genesMRPS6, ICA1L, PROCR Hypertension Linked via 2 of 5 related genesMRPS6, TCF21 Alzheimer disease Linked via 2 of 5 related genesMKX, ICA1L Stroke Linked via 2 of 5 related genesPROCR, TCF21

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Obstructive pulmonary disease	3	["MRPS6","ICA1L","PROCR"]
Migraine	3	["MRPS6","ICA1L","PROCR"]
Hypertension	2	["MRPS6","TCF21"]
Alzheimer disease	2	["MKX","ICA1L"]
Stroke	2	["PROCR","TCF21"]