Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	3695
Gene name	Integrin subunit beta 7
Gene symbol	ITGB7
Synonyms (NCBI Gene)	-
Chromosome	12
Chromosome location	12q13.13
Summary	This gene encodes a protein that is a member of the integrin superfamily. Members of this family are adhesion receptors that function in signaling from the extracellular matrix to the cell. Integrins are heterodimeric integral membrane proteins composed o

15 Show/Hide all (15)

miRTarBase ID	miRNA	Experiments
MIRT1074228	hsa-miR-1262	CLIP-seq
MIRT1074229	hsa-miR-3646	CLIP-seq
MIRT1074230	hsa-miR-3647-3p	CLIP-seq
MIRT1074231	hsa-miR-3662	CLIP-seq
MIRT1074232	hsa-miR-4455	CLIP-seq
MIRT1074233	hsa-miR-4639-3p	CLIP-seq
MIRT1074234	hsa-miR-4701-3p	CLIP-seq
MIRT1074235	hsa-miR-4714-5p	CLIP-seq
MIRT1074236	hsa-miR-4766-5p	CLIP-seq
MIRT1074237	hsa-miR-597	CLIP-seq
MIRT1074238	hsa-miR-609	CLIP-seq
MIRT1074239	hsa-miR-635	CLIP-seq
MIRT1074240	hsa-miR-668	CLIP-seq
MIRT2250212	hsa-miR-1293	CLIP-seq
MIRT2250213	hsa-miR-4483	CLIP-seq

Transcription factor	Regulation	Reference
MAF	Activation	17490615

41 Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IEA
GO:0002387	Process	Immune response in gut-associated lymphoid tissue	NAS	7687523
GO:0003366	Process	Cell-matrix adhesion involved in ameboidal cell migration	IMP	23986478
GO:0005178	Function	Integrin binding	IBA
GO:0005515	Function	Protein binding	IPI	1542691, 14681217, 17690686, 19828450, 21524097, 21926999, 22232704
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	TAS	2040616
GO:0007160	Process	Cell-matrix adhesion	IBA
GO:0007160	Process	Cell-matrix adhesion	IDA	22232704
GO:0007160	Process	Cell-matrix adhesion	IMP	18308860, 23986478
GO:0007229	Process	Integrin-mediated signaling pathway	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	IMP	23986478
GO:0007229	Process	Integrin-mediated signaling pathway	NAS	22232704
GO:0008305	Component	Integrin complex	IBA
GO:0008305	Component	Integrin complex	IEA
GO:0008305	Component	Integrin complex	TAS	2040616
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IDA	18308860, 23986478
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0033627	Process	Cell adhesion mediated by integrin	IBA
GO:0034113	Process	Heterotypic cell-cell adhesion	IMP	18308860
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IMP	23986478
GO:0034669	Component	Integrin alpha4-beta7 complex	IDA	18308860, 23986478
GO:0034669	Component	Integrin alpha4-beta7 complex	IPI	22232704
GO:0043113	Process	Receptor clustering	IMP	23986478
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050839	Function	Cell adhesion molecule binding	IMP	23986478
GO:0050900	Process	Leukocyte migration	IBA
GO:0050900	Process	Leukocyte migration	IEA
GO:0050900	Process	Leukocyte migration	IEA
GO:0050901	Process	Leukocyte tethering or rolling	IMP	18308860
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0072678	Process	T cell migration	IEA
GO:0098609	Process	Cell-cell adhesion	IBA

MIM	HGNC	e!Ensembl
147559	6162	ENSG00000139626

P26010

Protein name

Integrin beta-7 (Gut homing receptor beta subunit)

Protein function

Integrin ITGA4/ITGB7 (alpha-4/beta-7) (Peyer patches-specific homing receptor LPAM-1) is an adhesion molecule that mediates lymphocyte migration and homing to gut-associated lymphoid tissue (GALT) (Probable). Integrin ITGA4/ITGB7 interacts with

PDB

2BRQ , 3V4P , 3V4V , 8ZJF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00362	Integrin_beta	147 → 393	Integrin beta chain VWA domain	Domain
PF07974	EGF_2	605 → 635	EGF-like domain	Domain
PF08725	Integrin_b_cyt	747 → 791	Integrin beta cytoplasmic domain	Domain
PF17205	PSI_integrin	43 → 92	Integrin plexin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in a variety of leukocyte lines.

Sequence

MVALPMVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPS
CAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGA
TQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
RLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLERCQSPFSFHHVLSLTGDAQ
AFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTSAALPVYQELS
KLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKREG
KAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSD
TQPQAPHCSDGQGHLQCGVCSCAPGRLGRLCECSVAELSSPDLESGCRAPNGTGPLCSGK
GHCQCGRCSCSGQSSGHLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSG
DMDSCISPEGGLCSGHGRCKCNRCQCLDGYYGALCDQCPGCKTPCERHRDCAECGAFRTG
PLATNCSTACAHTNVTLALAPILDDGWCKERTLDNQLFFFLVEDDARGTVVLRVRPQEKG
ADHTQAIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREYSRFEKEQQQLNWKQDSNPLYKS
AITTTINPRFQEADSPTL

Sequence length

798

Interactions

View interactions

KEGG Pathway	Reactome Pathway
PI3K-Akt signaling pathway	Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Focal adhesion	Integrin cell surface interactions
ECM-receptor interaction
Cell adhesion molecules
Intestinal immune network for IgA production
Regulation of actin cytoskeleton
Cytoskeleton in muscle cells
Human papillomavirus infection
Transcriptional misregulation in cancer
Hypertrophic cardiomyopathy
Arrhythmogenic right ventricular cardiomyopathy
Dilated cardiomyopathy

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
ITGB8	[]	9	["Focal adhesion","ECM-receptor interaction","Cell adhesion molecules","Regulation of actin cytoskeleton","Cytoskeleton in muscle cells","Hypertrophic cardiomyopathy","Arrhythmogenic right ventricular cardiomyopathy","Dilated cardiomyopathy","Integrin cell surface interactions"]	[]
ITGA11	[]	8	["Focal adhesion","ECM-receptor interaction","Regulation of actin cytoskeleton","Cytoskeleton in muscle cells","Hypertrophic cardiomyopathy","Arrhythmogenic right ventricular cardiomyopathy","Dilated cardiomyopathy","Integrin cell surface interactions"]	[]
ITGA10	[]	8	["Focal adhesion","ECM-receptor interaction","Regulation of actin cytoskeleton","Cytoskeleton in muscle cells","Hypertrophic cardiomyopathy","Arrhythmogenic right ventricular cardiomyopathy","Dilated cardiomyopathy","Integrin cell surface interactions"]	[]
ITGA9	[]	9	["Focal adhesion","ECM-receptor interaction","Cell adhesion molecules","Regulation of actin cytoskeleton","Cytoskeleton in muscle cells","Hypertrophic cardiomyopathy","Arrhythmogenic right ventricular cardiomyopathy","Dilated cardiomyopathy","Integrin cell surface interactions"]	[]
ITGA8	[]	9	["Focal adhesion","ECM-receptor interaction","Cell adhesion molecules","Regulation of actin cytoskeleton","Cytoskeleton in muscle cells","Hypertrophic cardiomyopathy","Arrhythmogenic right ventricular cardiomyopathy","Dilated cardiomyopathy","Integrin cell surface interactions"]	[]

ITGB7 (integrin subunit beta 7)

Bookmark This Gene