ITGA10 (integrin subunit alpha 10)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 8515
• Gene name: Integrin subunit alpha 10
• Gene symbol: ITGA10
• Synonyms (NCBI Gene): PRO827
• Chromosome: 1
• Chromosome location: 1q21.1
• Summary: Integrins are integral transmembrane glycoproteins composed of noncovalently linked alpha and beta chains. They participate in cell adhesion as well as cell-surface mediated signalling. This gene encodes an integrin alpha chain and is expressed at high le

miRNA Show/Hide all (19)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017655	hsa-miR-335-5p	Microarray	18185580
MIRT051770	hsa-let-7c-5p	CLASH	23622248
MIRT755868	hsa-miR-4739	Luciferase reporter assay, Western blotting, qRT-PCR	36161100
MIRT1073368	hsa-miR-2115	CLIP-seq
MIRT1073369	hsa-miR-320a	CLIP-seq
MIRT1073370	hsa-miR-320b	CLIP-seq
MIRT1073371	hsa-miR-320c	CLIP-seq
MIRT1073372	hsa-miR-320d	CLIP-seq
MIRT1073373	hsa-miR-320e	CLIP-seq
MIRT1073374	hsa-miR-4429	CLIP-seq
MIRT1073375	hsa-miR-4490	CLIP-seq
MIRT1073376	hsa-miR-516a-3p	CLIP-seq
MIRT2249958	hsa-miR-1226	CLIP-seq
MIRT2249959	hsa-miR-15a	CLIP-seq
MIRT2249960	hsa-miR-15b	CLIP-seq
MIRT2249961	hsa-miR-16	CLIP-seq
MIRT2249962	hsa-miR-195	CLIP-seq
MIRT2249963	hsa-miR-424	CLIP-seq
MIRT2249964	hsa-miR-497	CLIP-seq

Gene ontology (GO) Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005518	Function	Collagen binding	TAS	9685391
GO:0005886	Component	Plasma membrane	TAS
GO:0007155	Process	Cell adhesion	IEA
GO:0007160	Process	Cell-matrix adhesion	IBA
GO:0007160	Process	Cell-matrix adhesion	IMP	24823363
GO:0007160	Process	Cell-matrix adhesion	NAS	19693543
GO:0007160	Process	Cell-matrix adhesion	TAS	9685391
GO:0007229	Process	Integrin-mediated signaling pathway	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	IMP	24823363
GO:0007229	Process	Integrin-mediated signaling pathway	NAS	19693543
GO:0008305	Component	Integrin complex	IEA
GO:0008305	Component	Integrin complex	TAS	9685391
GO:0009986	Component	Cell surface	IBA
GO:0016020	Component	Membrane	IEA
GO:0034680	Component	Integrin alpha10-beta1 complex	IBA
GO:0034680	Component	Integrin alpha10-beta1 complex	IDA	24823363
GO:0034680	Component	Integrin alpha10-beta1 complex	IPI	9685391
GO:0038023	Function	Signaling receptor activity	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0098609	Process	Cell-cell adhesion	IBA
GO:0098639	Function	Collagen binding involved in cell-matrix adhesion	IEA
GO:0098639	Function	Collagen binding involved in cell-matrix adhesion	IMP	24823363

Other IDs

• MIM: 604042
• HGNC: 6135
• e!Ensembl: ENSG00000143127

Protein

• UniProt ID: O75578
• Protein name: Integrin alpha-10
• Protein function: Integrin alpha-10/beta-1 is a receptor for collagen.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00092	VWA	167 → 349	von Willebrand factor type A domain	Domain
  PF01839	FG-GAP	549 → 584	FG-GAP repeat	Repeat
  PF01839	FG-GAP	486 → 525	FG-GAP repeat	Repeat
  PF08441	Integrin_alpha2	642 → 1059	Integrin alpha	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed with highest expression in muscle and heart. Found in articular cartilage.
• Sequence:

  MELPFVTHLFLPLVFLTGLCSPFNLDEHHPRLFPGPPEAEFGYSVLQHVGGGQRWMLVGA
  PWDGPSGDRRGDVYRCPVGGAHNAPCAKGHLGDYQLGNSSHPAVNMHLGMSLLETDGDGG
  FMACAPLWSRACGSSVFSSGICARVDASFQPQGSLAPTAQRCPTYMDVVIVLDGSNSIYP
  WSEVQTFLRRLVGKLFIDPEQIQVGLVQYGESPVHEWSLGDFRTKEEVVRAAKNLSRREG
  RETKTAQAIMVACTEGFSQSHGGRPEAARLLVVVTDGESHDGEELPAALKACEAGRVTRY
  GIAVLGHYLRRQRDPSSFLREIRTIASDPDERFFFNVTDEAALTDIVDALGDRIFGLEGS
  HAENESSFGLEMSQIGFSTHRLKDGILFGMVGAYDWGGSVLWLEGGHRLFPPRMALEDEF
  PPALQNHAAYLGYSVSSMLLRGGRRLFLSGAPRFRHRGKVIAFQLKKDGAVRVAQSLQGE
  QIGSYFGSELCPLDTDRDGTTDVLLVAAPMFLGPQNKETGRVYVYLVGQQSLLTLQGTLQ
  PEPPQDARFGFAMGALPDLNQDGFADVAVGAPLEDGHQGALYLYHGTQSGVRPHPAQRIA
  AASMPHALSYFGRSVDGRLDLDGDDLVDVAVGAQGAAILLSSRPIVHLTPSLEVTPQAIS
  VVQRDCRRRGQEAVCLTAALCFQVTSRTPGRWDHQFYMRFTASLDEWTAGARAAFDGSGQ
  RLSPRRLRLSVGNVTCEQLHFHVLDTSDYLRPVALTVTFALDNTTKPGPVLNEGSPTSIQ
  KLVPFSKDCGPDNECVTDLVLQVNMDIRGSRKAPFVVRGGRRKVLVSTTLENRKENAYNT
  SLSLIFSRNLHLASLTPQRESPIKVECAAPSAHARLCSVGHPVFQTGAKVTFLLEFEFSC
  SSLLSQVFVKLTASSDSLERNGTLQDNTAQTSAYIQYEPHLLFSSESTLHRYEVHPYGTL
  PVGPGPEFKTTLRVQNLGCYVVSGLIISALLPAVAHGGNYFLSLSQVITNNASCIVQNLT
  EPPGPPVHPEELQHTNRLNGSNTQCQVVRCHLGQLAKGTEVSVGLLRLVHNEFFRRAKFK
  SLTVVSTFELGTEEGSVLQLTEASRWSESLLEVVQTRPILISLWILIGSVLGGLLLLALL
  VFCLWKLGFFAHKKIPEEEKREEKLEQ

• Sequence length: 1167

Pathways

KEGG Pathway	Reactome Pathway
PI3K-Akt signaling pathway	Integrin cell surface interactions
Focal adhesion
ECM-receptor interaction
Regulation of actin cytoskeleton
Cytoskeleton in muscle cells
Human papillomavirus infection
Hypertrophic cardiomyopathy
Arrhythmogenic right ventricular cardiomyopathy
Dilated cardiomyopathy

Related Genes

Sort by: Blended Diseases Pathways Evidence source

ITGA11 8 shared pathwaysFocal adhesion, ECM-receptor interaction, Regulation of actin cytoskeleton, Cytoskeleton in muscle cells, Hypertrophic cardiomyopathy, Arrhythmogenic right ventricular cardiomyopathy, Dilated cardiomyopathy, Integrin cell surface interactions Related via 8 shared pathways including Focal adhesion, ECM-receptor interaction. ITGA1 8 shared pathwaysFocal adhesion, ECM-receptor interaction, Regulation of actin cytoskeleton, Cytoskeleton in muscle cells, Hypertrophic cardiomyopathy, Arrhythmogenic right ventricular cardiomyopathy, Dilated cardiomyopathy, Integrin cell surface interactions Related via 8 shared pathways including Focal adhesion, ECM-receptor interaction. ITGB8 8 shared pathwaysFocal adhesion, ECM-receptor interaction, Regulation of actin cytoskeleton, Cytoskeleton in muscle cells, Hypertrophic cardiomyopathy, Arrhythmogenic right ventricular cardiomyopathy, Dilated cardiomyopathy, Integrin cell surface interactions Related via 8 shared pathways including Focal adhesion, ECM-receptor interaction. ITGA9 8 shared pathwaysFocal adhesion, ECM-receptor interaction, Regulation of actin cytoskeleton, Cytoskeleton in muscle cells, Hypertrophic cardiomyopathy, Arrhythmogenic right ventricular cardiomyopathy, Dilated cardiomyopathy, Integrin cell surface interactions Related via 8 shared pathways including Focal adhesion, ECM-receptor interaction. ITGB6 8 shared pathwaysFocal adhesion, ECM-receptor interaction, Regulation of actin cytoskeleton, Cytoskeleton in muscle cells, Hypertrophic cardiomyopathy, Arrhythmogenic right ventricular cardiomyopathy, Dilated cardiomyopathy, Integrin cell surface interactions Related via 8 shared pathways including Focal adhesion, ECM-receptor interaction.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
ITGA11	0	[]	8	["Focal adhesion","ECM-receptor interaction","Regulation of actin cytoskeleton","Cytoskeleton in muscle cells","Hypertrophic cardiomyopathy","Arrhythmogenic right ventricular cardiomyopathy","Dilated cardiomyopathy","Integrin cell surface interactions"]	0	[]
ITGA1	0	[]	8	["Focal adhesion","ECM-receptor interaction","Regulation of actin cytoskeleton","Cytoskeleton in muscle cells","Hypertrophic cardiomyopathy","Arrhythmogenic right ventricular cardiomyopathy","Dilated cardiomyopathy","Integrin cell surface interactions"]	0	[]
ITGB8	0	[]	8	["Focal adhesion","ECM-receptor interaction","Regulation of actin cytoskeleton","Cytoskeleton in muscle cells","Hypertrophic cardiomyopathy","Arrhythmogenic right ventricular cardiomyopathy","Dilated cardiomyopathy","Integrin cell surface interactions"]	0	[]
ITGA9	0	[]	8	["Focal adhesion","ECM-receptor interaction","Regulation of actin cytoskeleton","Cytoskeleton in muscle cells","Hypertrophic cardiomyopathy","Arrhythmogenic right ventricular cardiomyopathy","Dilated cardiomyopathy","Integrin cell surface interactions"]	0	[]
ITGB6	0	[]	8	["Focal adhesion","ECM-receptor interaction","Regulation of actin cytoskeleton","Cytoskeleton in muscle cells","Hypertrophic cardiomyopathy","Arrhythmogenic right ventricular cardiomyopathy","Dilated cardiomyopathy","Integrin cell surface interactions"]	0	[]

Diseases Linked via Similar Genes

Diabetes mellitus type 2 Linked via 4 of 5 related genesITGA11, ITGA1, ITGB8, ITGB6 Alzheimer disease Linked via 2 of 5 related genesITGA11, ITGB8 Attention deficit hyperactivity disorder Linked via 2 of 5 related genesITGA11, ITGA1 Major depressive disorder Linked via 2 of 5 related genesITGA11, ITGA9 Obstructive pulmonary disease Linked via 2 of 5 related genesITGA1, ITGB8

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Diabetes mellitus type 2	4	["ITGA11","ITGA1","ITGB8","ITGB6"]
Alzheimer disease	2	["ITGA11","ITGB8"]
Attention deficit hyperactivity disorder	2	["ITGA11","ITGA1"]
Major depressive disorder	2	["ITGA11","ITGA9"]
Obstructive pulmonary disease	2	["ITGA1","ITGB8"]