Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	3681
Gene name	Integrin subunit alpha D
Gene symbol	ITGAD
Synonyms (NCBI Gene)	ADB2CD11D
Chromosome	16
Chromosome location	16p11.2
Summary	This gene belongs to the beta-2 integrin family of membrane glycoproteins, which are are composed of non-covalently linked alpha and beta subunits to form a heterodimer. It encodes the alpha subunit of the cell surface heterodimers and is involved in the

11 Show/Hide all (11)

miRTarBase ID	miRNA	Experiments
MIRT1073743	hsa-miR-148a	CLIP-seq
MIRT1073744	hsa-miR-148b	CLIP-seq
MIRT1073745	hsa-miR-152	CLIP-seq
MIRT1073746	hsa-miR-1825	CLIP-seq
MIRT1073747	hsa-miR-298	CLIP-seq
MIRT1073748	hsa-miR-382	CLIP-seq
MIRT2250091	hsa-miR-3182	CLIP-seq
MIRT2250092	hsa-miR-3607-3p	CLIP-seq
MIRT2250093	hsa-miR-3686	CLIP-seq
MIRT2250094	hsa-miR-4763-5p	CLIP-seq
MIRT2250095	hsa-miR-548t	CLIP-seq

Transcription factor	Regulation	Reference
KLF10	Activation	15087465
SP1	Activation	10722744
SP3	Activation	10722744

18 Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	NAS	9841932
GO:0007155	Process	Cell adhesion	IEA
GO:0007160	Process	Cell-matrix adhesion	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0008305	Component	Integrin complex	IBA
GO:0008305	Component	Integrin complex	IEA
GO:0008305	Component	Integrin complex	TAS	20187620
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IC	20563599
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0034113	Process	Heterotypic cell-cell adhesion	IMP	20563599
GO:0038023	Function	Signaling receptor activity	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0098609	Process	Cell-cell adhesion	IBA

MIM	HGNC	e!Ensembl
602453	6146	ENSG00000156886

Q13349

Protein name

Integrin alpha-D (ADB2) (CD11 antigen-like family member D) (Leukointegrin alpha D) (CD antigen CD11d)

Protein function

Integrin alpha-D/beta-2 is a receptor for ICAM3 and VCAM1. May play a role in the atherosclerotic process such as clearing lipoproteins from plaques and in phagocytosis of blood-borne pathogens, particulate matter, and senescent erythrocytes fro

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00092	VWA	150 → 327	von Willebrand factor type A domain	Domain
PF00357	Integrin_alpha	1124 → 1138	Integrin alpha cytoplasmic region	Family
PF01839	FG-GAP	457 → 494	FG-GAP repeat	Repeat
PF08441	Integrin_alpha2	614 → 963	Integrin alpha	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed moderately on myelomonocytic cell lines and subsets of peripheral blood leukocytes and strongly on tissue-specialized cells, including macrophages foam cells within atherosclerotic plaques, and on splenic red pulp macrophages

Sequence

MTFGTVLLLSVLASYHGFNLDVEEPTIFQEDAGGFGQSVVQFGGSRLVVGAPLEVVAANQ
TGRLYDCAAATGMCQPIPLHIRPEAVNMSLGLTLAASTNGSRLLACGPTLHRVCGENSYS
KGSCLLLGSRWEIIQTVPDATPECPHQEMDIVFLIDGSGSIDQNDFNQMKGFVQAVMGQF
EGTDTLFALMQYSNLLKIHFTFTQFRTSPSQQSLVDPIVQLKGLTFTATGILTVVTQLFH
HKNGARKSAKKILIVITDGQKYKDPLEYSDVIPQAEKAGIIRYAIGVGHAFQGPTARQEL
NTISSAPPQDHVFKVDNFAALGSIQKQLQEKIYAVEGTQSRASSSFQHEMSQEGFSTALT
MDGLFLGAVGSFSWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQNLV
LGAPRYQHTGKAVIFTQVSRQWRKKAEVTGTQIGSYFGASLCSVDVDSDGSTDLILIGAP
HYYEQTRGGQVSVCPLPRGRVQWQCDAVLRGEQGHPWGRFGAALTVLGDVNEDKLIDVAI
GAPGEQENRGAVYLFHGASESGISPSHSQRIASSQLSPRLQYFGQALSGGQDLTQDGLMD
LAVGARGQVLLLRSLPVLKVGVAMRFSPVEVAKAVYRCWEEKPSALEAGDATVCLTIQKS
SLDQLGDIQSSVRFDLALDPGRLTSRAIFNETKNPTLTRRKTLGLGIHCETLKLLLPDCV
EDVVSPIILHLNFSLVREPIPSPQNLRPVLAVGSQDLFTASLPFEKNCGQDGLCEGDLGV
TLSFSGLQTLTVGSSLELNVIVTVWNAGEDSYGTVVSLYYPAGLSHRRVSGAQKQPHQSA
LRLACETVPTEDEGLRSSRCSVNHPIFHEGSNGTFIVTFDVSYKATLGDRMLMRASASSE
NNKASSSKATFQLELPVKYAVYTMISRQEESTKYFNFATSDEKKMKEAEHRYRVNNLSQR
DLAISINFWVPVLLNGVAVWDVVMEAPSQSLPCVSERKPPQHSDFLTQISRSPMLDCSIA
DCLQFRCDVPSFSVQEELDFTLKGNLSFGWVRETLQKKVLVVSVAEITFDTSVYSQLPGQ
EAFMRAQMEMVLEEDEVYNAIPIIMGSSVGALLLLALITATLYKLGFFKRHYKEMLEDKP
EDTATFSGDDFSCVAPNVPLS

Sequence length

1161

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Regulation of actin cytoskeleton	Integrin cell surface interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Prostate cancer	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arteriosclerosis	Arteriosclerosis	BEFREE	28500072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28500072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	28587875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	21508205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26330360	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ITGAD (integrin subunit alpha D)

Save This Analysis