IFNA8 (interferon alpha 8)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 3445
• Gene name: Interferon alpha 8
• Gene symbol: IFNA8
• Synonyms (NCBI Gene): IFN-alphaB
• Chromosome: 9
• Chromosome location: 9p21.3

miRNA Show/Hide all (13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1060640	hsa-miR-4328	CLIP-seq
MIRT1060641	hsa-miR-507	CLIP-seq
MIRT1060642	hsa-miR-557	CLIP-seq
MIRT2549842	hsa-miR-1323	CLIP-seq
MIRT2549843	hsa-miR-3129-3p	CLIP-seq
MIRT2549844	hsa-miR-4503	CLIP-seq
MIRT2549845	hsa-miR-4735-5p	CLIP-seq
MIRT2549846	hsa-miR-548o	CLIP-seq
MIRT2549842	hsa-miR-1323	CLIP-seq
MIRT2549843	hsa-miR-3129-3p	CLIP-seq
MIRT2549844	hsa-miR-4503	CLIP-seq
MIRT2549845	hsa-miR-4735-5p	CLIP-seq
MIRT2549846	hsa-miR-548o	CLIP-seq

Gene ontology (GO) Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IBA
GO:0002286	Process	T cell activation involved in immune response	IBA
GO:0002312	Process	B cell activation involved in immune response	IBA
GO:0002323	Process	Natural killer cell activation involved in immune response	IBA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IEA
GO:0005126	Function	Cytokine receptor binding	IEA
GO:0005126	Function	Cytokine receptor binding	TAS	6163083
GO:0005132	Function	Type I interferon receptor binding	IBA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006952	Process	Defense response	IEA
GO:0006959	Process	Humoral immune response	IBA
GO:0043330	Process	Response to exogenous dsRNA	IBA
GO:0051607	Process	Defense response to virus	IEA
GO:0060337	Process	Type I interferon-mediated signaling pathway	IBA
GO:0060337	Process	Type I interferon-mediated signaling pathway	NAS	30936491
GO:0098586	Process	Cellular response to virus	NAS	30936491

Other IDs

• MIM: 147568
• HGNC: 5429
• e!Ensembl: ENSG00000120242

Protein

• UniProt ID: P32881
• Protein name: Interferon alpha-8 (IFN-alpha-8) (Interferon alpha-B) (LeIF B) (Interferon alpha-B2)
• Protein function: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
• PDB: 6JHD
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00143	Interferon	26 → 185	Interferon alpha/beta domain	Domain

• Sequence:

  MALTFYLLVALVVLSYKSFSSLGCDLPQTHSLGNRRALILLAQMRRISPFSCLKDRHDFE
  FPQEEFDDKQFQKAQAISVLHEMIQQTFNLFSTKDSSAALDETLLDEFYIELDQQLNDLE
  SCVMQEVGVIESPLMYEDSILAVRKYFQRITLYLTEKKYSSCAWEVVRAEIMRSFSLSIN
  LQKRLKSKE

• Sequence length: 189

Pathways

KEGG Pathway	Reactome Pathway
Cytokine-cytokine receptor interaction	Interferon alpha/beta signaling
PI3K-Akt signaling pathway	Regulation of IFNA signaling
Necroptosis	TRAF6 mediated IRF7 activation
Toll-like receptor signaling pathway	Factors involved in megakaryocyte development and platelet production
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
JAK-STAT signaling pathway
Natural killer cell mediated cytotoxicity
Alcoholic liver disease
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Human cytomegalovirus infection
Influenza A
Human papillomavirus infection
Kaposi sarcoma-associated herpesvirus infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Human immunodeficiency virus 1 infection
Coronavirus disease - COVID-19
Pathways in cancer
Autoimmune thyroid disease
Lipid and atherosclerosis

Related Genes

Sort by: Blended Diseases Pathways Evidence source

IFNA1 26 shared pathwaysCytokine-cytokine receptor interaction, Necroptosis, Toll-like receptor signaling pathway, NOD-like receptor signaling pathway, RIG-I-like receptor signaling pathway, Cytosolic DNA-sensing pathway, JAK-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Alcoholic liver disease, Tuberculosis, Hepatitis C, Hepatitis B +14 more Related via 26 shared pathways including Cytokine-cytokine receptor interaction, Necroptosis. IFNA2 26 shared pathwaysCytokine-cytokine receptor interaction, Necroptosis, Toll-like receptor signaling pathway, NOD-like receptor signaling pathway, RIG-I-like receptor signaling pathway, Cytosolic DNA-sensing pathway, JAK-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Alcoholic liver disease, Tuberculosis, Hepatitis C, Hepatitis B +14 more Related via 26 shared pathways including Cytokine-cytokine receptor interaction, Necroptosis. IFNA4 26 shared pathwaysCytokine-cytokine receptor interaction, Necroptosis, Toll-like receptor signaling pathway, NOD-like receptor signaling pathway, RIG-I-like receptor signaling pathway, Cytosolic DNA-sensing pathway, JAK-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Alcoholic liver disease, Tuberculosis, Hepatitis C, Hepatitis B +14 more Related via 26 shared pathways including Cytokine-cytokine receptor interaction, Necroptosis. IFNA5 26 shared pathwaysCytokine-cytokine receptor interaction, Necroptosis, Toll-like receptor signaling pathway, NOD-like receptor signaling pathway, RIG-I-like receptor signaling pathway, Cytosolic DNA-sensing pathway, JAK-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Alcoholic liver disease, Tuberculosis, Hepatitis C, Hepatitis B +14 more Related via 26 shared pathways including Cytokine-cytokine receptor interaction, Necroptosis. IFNA6 26 shared pathwaysCytokine-cytokine receptor interaction, Necroptosis, Toll-like receptor signaling pathway, NOD-like receptor signaling pathway, RIG-I-like receptor signaling pathway, Cytosolic DNA-sensing pathway, JAK-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Alcoholic liver disease, Tuberculosis, Hepatitis C, Hepatitis B +14 more Related via 26 shared pathways including Cytokine-cytokine receptor interaction, Necroptosis.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
IFNA1	0	[]	26	["Cytokine-cytokine receptor interaction","Necroptosis","Toll-like receptor signaling pathway","NOD-like receptor signaling pathway","RIG-I-like receptor signaling pathway","Cytosolic DNA-sensing pathway","JAK-STAT signaling pathway","Natural killer cell mediated cytotoxicity","Alcoholic liver disease","Tuberculosis","Hepatitis C","Hepatitis B"]	0	[]
IFNA2	0	[]	26	["Cytokine-cytokine receptor interaction","Necroptosis","Toll-like receptor signaling pathway","NOD-like receptor signaling pathway","RIG-I-like receptor signaling pathway","Cytosolic DNA-sensing pathway","JAK-STAT signaling pathway","Natural killer cell mediated cytotoxicity","Alcoholic liver disease","Tuberculosis","Hepatitis C","Hepatitis B"]	0	[]
IFNA4	0	[]	26	["Cytokine-cytokine receptor interaction","Necroptosis","Toll-like receptor signaling pathway","NOD-like receptor signaling pathway","RIG-I-like receptor signaling pathway","Cytosolic DNA-sensing pathway","JAK-STAT signaling pathway","Natural killer cell mediated cytotoxicity","Alcoholic liver disease","Tuberculosis","Hepatitis C","Hepatitis B"]	0	[]
IFNA5	0	[]	26	["Cytokine-cytokine receptor interaction","Necroptosis","Toll-like receptor signaling pathway","NOD-like receptor signaling pathway","RIG-I-like receptor signaling pathway","Cytosolic DNA-sensing pathway","JAK-STAT signaling pathway","Natural killer cell mediated cytotoxicity","Alcoholic liver disease","Tuberculosis","Hepatitis C","Hepatitis B"]	0	[]
IFNA6	0	[]	26	["Cytokine-cytokine receptor interaction","Necroptosis","Toll-like receptor signaling pathway","NOD-like receptor signaling pathway","RIG-I-like receptor signaling pathway","Cytosolic DNA-sensing pathway","JAK-STAT signaling pathway","Natural killer cell mediated cytotoxicity","Alcoholic liver disease","Tuberculosis","Hepatitis C","Hepatitis B"]	0	[]

Diseases Linked via Similar Genes

Melanoma Linked via 3 of 5 related genesIFNA1, IFNA2, IFNA5 Pancreatic neoplasms Linked via 3 of 5 related genesIFNA1, IFNA2, IFNA5 Colorectal neoplasms Linked via 2 of 5 related genesIFNA1, IFNA2 T-cell leukemia-lymphoma Linked via 2 of 5 related genesIFNA1, IFNA2 Liver cirrhosis Linked via 2 of 5 related genesIFNA1, IFNA2

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Melanoma	3	["IFNA1","IFNA2","IFNA5"]
Pancreatic neoplasms	3	["IFNA1","IFNA2","IFNA5"]
Colorectal neoplasms	2	["IFNA1","IFNA2"]
T-cell leukemia-lymphoma	2	["IFNA1","IFNA2"]
Liver cirrhosis	2	["IFNA1","IFNA2"]