HDAC10 (histone deacetylase 10)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 83933
• Gene name: Histone deacetylase 10
• Gene symbol: HDAC10
• Synonyms (NCBI Gene): HD10
• Chromosome: 22
• Chromosome location: 22q13.33
• Summary: The protein encoded by this gene belongs to the histone deacetylase family, members of which deacetylate lysine residues on the N-terminal part of the core histones. Histone deacetylation modulates chromatin structure, and plays an important role in trans

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT050881	hsa-miR-17-5p	CLASH	23622248
MIRT732542	hsa-miR-223-3p	Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	33481338
MIRT732778	hsa-miR-1908-3p	Luciferase reporter assay, qRT-PCR	33493381
MIRT2008891	hsa-miR-744	CLIP-seq

Gene ontology (GO) Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000118	Component	Histone deacetylase complex	IDA	11861901
GO:0000118	Component	Histone deacetylase complex	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	11726666
GO:0004407	Function	Histone deacetylase activity	IDA	11739383, 11861901
GO:0004407	Function	Histone deacetylase activity	TAS
GO:0005515	Function	Protein binding	IPI	17172643, 23801752, 26221039, 31391242, 32814053
GO:0005634	Component	Nucleus	IDA	11739383, 11861901
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	11726666
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	11726666, 11861901
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0006281	Process	DNA repair	IEA
GO:0006310	Process	DNA recombination	IEA
GO:0006325	Process	Chromatin organization	NAS	11861901
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	11861901
GO:0006914	Process	Autophagy	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0008270	Function	Zinc ion binding	ISS
GO:0016236	Process	Macroautophagy	IEA
GO:0016236	Process	Macroautophagy	IMP	23801752
GO:0016787	Function	Hydrolase activity	IEA
GO:0019213	Function	Deacetylase activity	IBA
GO:0019213	Function	Deacetylase activity	IDA	28516954
GO:0019899	Function	Enzyme binding	IPI	11861901
GO:0032425	Process	Positive regulation of mismatch repair	IDA	26221039
GO:0033558	Function	Protein lysine deacetylase activity	IDA	28516954
GO:0033558	Function	Protein lysine deacetylase activity	IDA	17172643, 26221039
GO:0035825	Process	Homologous recombination	IMP	21247901
GO:0042826	Function	Histone deacetylase binding	IDA	11861901
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	11726666, 11861901
GO:0046872	Function	Metal ion binding	IEA
GO:0047609	Function	Acetylputrescine deacetylase activity	IEA
GO:0047611	Function	Acetylspermidine deacetylase activity	IEA
GO:0098732	Process	Macromolecule deacylation	IEA
GO:0106047	Process	Polyamine deacetylation	IDA	28516954
GO:0106048	Process	Spermidine deacetylation	IBA
GO:0106048	Process	Spermidine deacetylation	IDA	28516954

Other IDs

• MIM: 608544
• HGNC: 18128
• e!Ensembl: ENSG00000100429

Protein

• UniProt ID: Q969S8
• Protein name: Polyamine deacetylase HDAC10 (EC 3.5.1.48) (EC 3.5.1.62) (Histone deacetylase 10) (HD10)
• Protein function: Polyamine deacetylase (PDAC), which acts preferentially on N(8)-acetylspermidine, and also on acetylcadaverine and acetylputrescine (PubMed:28516954). Exhibits attenuated catalytic activity toward N(1),N(8)-diacetylspermidine and very low activi
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00850	Hist_deacetyl	24 → 321	Histone deacetylase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed with high levels in liver and kidney. {ECO:0000269|PubMed:11677242, ECO:0000269|PubMed:11739383, ECO:0000269|PubMed:11861901}.
• Sequence:

  MGTALVYHEDMTATRLLWDDPECEIERPERLTAALDRLRQRGLEQRCLRLSAREASEEEL
  GLVHSPEYVSLVRETQVLGKEELQALSGQFDAIYFHPSTFHCARLAAGAGLQLVDAVLTG
  AVQNGLALVRPPGHHGQRAAANGFCVFNNVAIAAAHAKQKHGLHRILVVDWDVHHGQGIQ
  YLFEDDPSVLYFSWHRYEHGRFWPFLRESDADAVGRGQGLGFTVNLPWNQVGMGNADYVA
  AFLHLLLPLAFEFDPELVLVSAGFDSAIGDPEGQMQATPECFAHLTQLLQVLAGGRVCAV
  LEGGYHLESLAESVCMTVQTLLGDPAPPLSGPMAPCQSALESIQSARAAQAPHWKSLQQQ
  DVTAVPMSPSSHSPEGRPPPLLPGGPVCKAAASAPSSLLDQPCLCPAPSVRTAVALTTPD
  ITLVLPPDVIQQEASALREETEAWARPHESLAREEALTALGKLLYLLDGMLDGQVNSGIA
  ATPASAAAATLDVAVRRGLSHGAQRLLCVALGQLDRPPDLAHDGRSLWLNIRGKEAAALS
  MFHVSTPLPVMTGGFLSCILGLVLPLAYGFQPDLVLVALGPGHGLQGPHAALLAAMLRGL
  AGGRVLALLEENSTPQLAGILARVLNGEAPPSLGPSSVASPEDVQALMYLRGQLEPQWKM
  LQCHPHLVA

• Sequence length: 669

Pathways

KEGG Pathway	Reactome Pathway
Neutrophil extracellular trap formation	Constitutive Signaling by NOTCH1 PEST Domain Mutants
Alcoholism	Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
Viral carcinogenesis	HDACs deacetylate histones
	Notch-HLH transcription pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Colon adenocarcinoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (31)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	28418763		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27449083		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34308568, 39237939	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28073598		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	27246213		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29085502		★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	30214182	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37528157	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	30029622	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	1632463, 28418763		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31635225		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	15305372		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27449083		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28073598		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27246213, 27449083, 29533602		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29085502		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	27246213		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24850177	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	25482492	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28073598, 31285420		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	23801752, 29947893, 29968769	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	24145760, 29947893, 29968769, 30964290		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28073598		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28073598	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	30214182	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	30214182		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20680488	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25337229, 34232196	Inhibit	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35685866	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33493381	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

HDAC11 6 shared pathwaysNeutrophil extracellular trap formation, Alcoholism, Viral carcinogenesis, Constitutive Signaling by NOTCH1 PEST Domain Mutants, Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants, Notch-HLH transcription pathway Related via 6 shared pathways including Neutrophil extracellular trap formation, Alcoholism. HDAC9 6 shared pathwaysNeutrophil extracellular trap formation, Alcoholism, Viral carcinogenesis, Constitutive Signaling by NOTCH1 PEST Domain Mutants, Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants, Notch-HLH transcription pathway Related via 6 shared pathways including Neutrophil extracellular trap formation, Alcoholism. HDAC5 6 shared pathwaysNeutrophil extracellular trap formation, Alcoholism, Viral carcinogenesis, Constitutive Signaling by NOTCH1 PEST Domain Mutants, Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants, Notch-HLH transcription pathway Related via 6 shared pathways including Neutrophil extracellular trap formation, Alcoholism. HDAC7 6 shared pathwaysNeutrophil extracellular trap formation, Alcoholism, Viral carcinogenesis, Constitutive Signaling by NOTCH1 PEST Domain Mutants, Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants, Notch-HLH transcription pathway Related via 6 shared pathways including Neutrophil extracellular trap formation, Alcoholism. HDAC8 7 shared pathwaysNeutrophil extracellular trap formation, Alcoholism, Viral carcinogenesis, Constitutive Signaling by NOTCH1 PEST Domain Mutants, Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants, Notch-HLH transcription pathway, HDACs deacetylate histones Related via 7 shared pathways including Neutrophil extracellular trap formation, Alcoholism.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
HDAC11	0	[]	6	["Neutrophil extracellular trap formation","Alcoholism","Viral carcinogenesis","Constitutive Signaling by NOTCH1 PEST Domain Mutants","Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants","Notch-HLH transcription pathway"]	0	[]
HDAC9	0	[]	6	["Neutrophil extracellular trap formation","Alcoholism","Viral carcinogenesis","Constitutive Signaling by NOTCH1 PEST Domain Mutants","Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants","Notch-HLH transcription pathway"]	0	[]
HDAC5	0	[]	6	["Neutrophil extracellular trap formation","Alcoholism","Viral carcinogenesis","Constitutive Signaling by NOTCH1 PEST Domain Mutants","Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants","Notch-HLH transcription pathway"]	0	[]
HDAC7	0	[]	6	["Neutrophil extracellular trap formation","Alcoholism","Viral carcinogenesis","Constitutive Signaling by NOTCH1 PEST Domain Mutants","Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants","Notch-HLH transcription pathway"]	0	[]
HDAC8	0	[]	7	["Neutrophil extracellular trap formation","Alcoholism","Viral carcinogenesis","Constitutive Signaling by NOTCH1 PEST Domain Mutants","Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants","Notch-HLH transcription pathway","HDACs deacetylate histones"]	0	[]

Diseases Linked via Similar Genes

Osteoarthritis Linked via 3 of 5 related genesHDAC11, HDAC9, HDAC5 Obstructive pulmonary disease Linked via 2 of 5 related genesHDAC9, HDAC7 Major depressive disorder Linked via 2 of 5 related genesHDAC9, HDAC5 Obesity Linked via 2 of 5 related genesHDAC9, HDAC7 Ulcerative colitis Linked via 2 of 5 related genesHDAC9, HDAC7

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Osteoarthritis	3	["HDAC11","HDAC9","HDAC5"]
Obstructive pulmonary disease	2	["HDAC9","HDAC7"]
Major depressive disorder	2	["HDAC9","HDAC5"]
Obesity	2	["HDAC9","HDAC7"]
Ulcerative colitis	2	["HDAC9","HDAC7"]