Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	2962
Gene name	General transcription factor IIF subunit 1
Gene symbol	GTF2F1
Synonyms (NCBI Gene)	BTF4RAP74TF2F1TFIIF
Chromosome	19
Chromosome location	19p13.3

167 Show/Hide all (167)

miRTarBase ID	miRNA	Experiments	Reference
MIRT038149	hsa-miR-423-5p	CLASH	23622248
MIRT644509	hsa-miR-4728-3p	HITS-CLIP	23824327
MIRT644508	hsa-miR-3190-5p	HITS-CLIP	23824327
MIRT644507	hsa-miR-494-3p	HITS-CLIP	23824327
MIRT644506	hsa-miR-4786-5p	HITS-CLIP	23824327
MIRT644505	hsa-miR-3926	HITS-CLIP	23824327
MIRT644504	hsa-miR-548s	HITS-CLIP	23824327
MIRT515508	hsa-miR-5693	PAR-CLIP	23446348
MIRT454429	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT515507	hsa-miR-3135b	PAR-CLIP	23446348
MIRT515506	hsa-miR-504-3p	PAR-CLIP	23446348
MIRT515505	hsa-miR-122-5p	PAR-CLIP	23446348
MIRT515504	hsa-miR-3652	PAR-CLIP	23446348
MIRT515503	hsa-miR-4430	PAR-CLIP	23446348
MIRT515502	hsa-miR-5698	PAR-CLIP	23446348
MIRT515501	hsa-miR-143-5p	PAR-CLIP	23446348
MIRT515500	hsa-miR-3943	PAR-CLIP	23446348
MIRT515499	hsa-miR-6760-5p	PAR-CLIP	23446348
MIRT515498	hsa-miR-586	PAR-CLIP	23446348
MIRT515497	hsa-miR-7515	PAR-CLIP	23446348
MIRT515496	hsa-miR-29c-5p	PAR-CLIP	23446348
MIRT515495	hsa-miR-6076	PAR-CLIP	23446348
MIRT515494	hsa-miR-6797-3p	PAR-CLIP	23446348
MIRT515493	hsa-miR-6878-5p	PAR-CLIP	23446348
MIRT515492	hsa-miR-3653-3p	PAR-CLIP	23446348
MIRT454438	hsa-miR-302f	PAR-CLIP	23592263
MIRT454436	hsa-miR-4324	PAR-CLIP	23592263
MIRT454437	hsa-miR-6761-5p	PAR-CLIP	23592263
MIRT454435	hsa-miR-219b-3p	PAR-CLIP	23592263
MIRT454434	hsa-miR-3160-3p	PAR-CLIP	23592263
MIRT454433	hsa-miR-558	PAR-CLIP	23592263
MIRT454432	hsa-miR-4487	PAR-CLIP	23592263
MIRT454431	hsa-miR-6134	PAR-CLIP	23592263
MIRT454430	hsa-miR-377-5p	PAR-CLIP	23592263
MIRT454428	hsa-miR-6086	PAR-CLIP	23592263
MIRT454429	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT454427	hsa-miR-3689d	PAR-CLIP	23592263
MIRT454426	hsa-miR-6851-5p	PAR-CLIP	23592263
MIRT454425	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT454424	hsa-miR-7847-3p	PAR-CLIP	23592263
MIRT454423	hsa-miR-455-3p	PAR-CLIP	23592263
MIRT454422	hsa-miR-1273e	PAR-CLIP	23592263
MIRT454421	hsa-miR-6516-5p	PAR-CLIP	23592263
MIRT440529	hsa-miR-136-3p	HITS-CLIP	24374217
MIRT440529	hsa-miR-136-3p	HITS-CLIP	24374217
MIRT515492	hsa-miR-3653-3p	PAR-CLIP	26701625
MIRT454437	hsa-miR-6761-5p	PAR-CLIP	26701625
MIRT644509	hsa-miR-4728-3p	HITS-CLIP	23824327
MIRT644508	hsa-miR-3190-5p	HITS-CLIP	23824327
MIRT644507	hsa-miR-494-3p	HITS-CLIP	23824327
MIRT644506	hsa-miR-4786-5p	HITS-CLIP	23824327
MIRT644505	hsa-miR-3926	HITS-CLIP	23824327
MIRT644504	hsa-miR-548s	HITS-CLIP	23824327
MIRT515508	hsa-miR-5693	PAR-CLIP	23446348
MIRT454429	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT515507	hsa-miR-3135b	PAR-CLIP	23446348
MIRT515506	hsa-miR-504-3p	PAR-CLIP	23446348
MIRT515505	hsa-miR-122-5p	PAR-CLIP	23446348
MIRT515504	hsa-miR-3652	PAR-CLIP	23446348
MIRT515503	hsa-miR-4430	PAR-CLIP	23446348
MIRT515502	hsa-miR-5698	PAR-CLIP	23446348
MIRT515501	hsa-miR-143-5p	PAR-CLIP	23446348
MIRT515500	hsa-miR-3943	PAR-CLIP	23446348
MIRT515499	hsa-miR-6760-5p	PAR-CLIP	23446348
MIRT515498	hsa-miR-586	PAR-CLIP	23446348
MIRT515497	hsa-miR-7515	PAR-CLIP	23446348
MIRT515496	hsa-miR-29c-5p	PAR-CLIP	23446348
MIRT515495	hsa-miR-6076	PAR-CLIP	23446348
MIRT515494	hsa-miR-6797-3p	PAR-CLIP	23446348
MIRT515493	hsa-miR-6878-5p	PAR-CLIP	23446348
MIRT515492	hsa-miR-3653-3p	PAR-CLIP	23446348
MIRT454438	hsa-miR-302f	PAR-CLIP	23592263
MIRT454436	hsa-miR-4324	PAR-CLIP	23592263
MIRT454437	hsa-miR-6761-5p	PAR-CLIP	23592263
MIRT454435	hsa-miR-219b-3p	PAR-CLIP	23592263
MIRT454434	hsa-miR-3160-3p	PAR-CLIP	23592263
MIRT454433	hsa-miR-558	PAR-CLIP	23592263
MIRT454432	hsa-miR-4487	PAR-CLIP	23592263
MIRT454431	hsa-miR-6134	PAR-CLIP	23592263
MIRT454430	hsa-miR-377-5p	PAR-CLIP	23592263
MIRT454428	hsa-miR-6086	PAR-CLIP	23592263
MIRT454429	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT454427	hsa-miR-3689d	PAR-CLIP	23592263
MIRT454426	hsa-miR-6851-5p	PAR-CLIP	23592263
MIRT454425	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT454424	hsa-miR-7847-3p	PAR-CLIP	23592263
MIRT454423	hsa-miR-455-3p	PAR-CLIP	23592263
MIRT454422	hsa-miR-1273e	PAR-CLIP	23592263
MIRT454421	hsa-miR-6516-5p	PAR-CLIP	23592263
MIRT1036841	hsa-miR-1252	CLIP-seq
MIRT1036842	hsa-miR-1291	CLIP-seq
MIRT1036843	hsa-miR-1299	CLIP-seq
MIRT1036844	hsa-miR-3180-5p	CLIP-seq
MIRT1036845	hsa-miR-3192	CLIP-seq
MIRT1036846	hsa-miR-3202	CLIP-seq
MIRT1036847	hsa-miR-3616-3p	CLIP-seq
MIRT1036848	hsa-miR-4292	CLIP-seq
MIRT1036849	hsa-miR-4436b-3p	CLIP-seq
MIRT1036850	hsa-miR-4476	CLIP-seq
MIRT1036851	hsa-miR-4640-5p	CLIP-seq
MIRT1036852	hsa-miR-4670-3p	CLIP-seq
MIRT1036853	hsa-miR-4699-5p	CLIP-seq
MIRT1036854	hsa-miR-4726-5p	CLIP-seq
MIRT1036855	hsa-miR-4782-5p	CLIP-seq
MIRT1036856	hsa-miR-516b	CLIP-seq
MIRT1036857	hsa-miR-520a-5p	CLIP-seq
MIRT1036858	hsa-miR-525-5p	CLIP-seq
MIRT2007394	hsa-miR-1	CLIP-seq
MIRT1036841	hsa-miR-1252	CLIP-seq
MIRT2007395	hsa-miR-1273f	CLIP-seq
MIRT2007396	hsa-miR-1298	CLIP-seq
MIRT2007397	hsa-miR-135a	CLIP-seq
MIRT2007398	hsa-miR-135b	CLIP-seq
MIRT2007399	hsa-miR-206	CLIP-seq
MIRT2007400	hsa-miR-3150b-3p	CLIP-seq
MIRT1036844	hsa-miR-3180-5p	CLIP-seq
MIRT1036846	hsa-miR-3202	CLIP-seq
MIRT2007401	hsa-miR-3673	CLIP-seq
MIRT2007402	hsa-miR-4418	CLIP-seq
MIRT1036850	hsa-miR-4476	CLIP-seq
MIRT1036851	hsa-miR-4640-5p	CLIP-seq
MIRT1036852	hsa-miR-4670-3p	CLIP-seq
MIRT1036853	hsa-miR-4699-5p	CLIP-seq
MIRT1036854	hsa-miR-4726-5p	CLIP-seq
MIRT2007403	hsa-miR-4778-5p	CLIP-seq
MIRT2007404	hsa-miR-4784	CLIP-seq
MIRT2007405	hsa-miR-509-3-5p	CLIP-seq
MIRT2007406	hsa-miR-509-5p	CLIP-seq
MIRT1036857	hsa-miR-520a-5p	CLIP-seq
MIRT1036858	hsa-miR-525-5p	CLIP-seq
MIRT2007407	hsa-miR-562	CLIP-seq
MIRT2007408	hsa-miR-613	CLIP-seq
MIRT2007409	hsa-miR-767-5p	CLIP-seq
MIRT2007394	hsa-miR-1	CLIP-seq
MIRT2240083	hsa-miR-1184	CLIP-seq
MIRT2240084	hsa-miR-122	CLIP-seq
MIRT2007399	hsa-miR-206	CLIP-seq
MIRT1036846	hsa-miR-3202	CLIP-seq
MIRT2240085	hsa-miR-3545-3p	CLIP-seq
MIRT2007401	hsa-miR-3673	CLIP-seq
MIRT2007402	hsa-miR-4418	CLIP-seq
MIRT2007403	hsa-miR-4778-5p	CLIP-seq
MIRT2007405	hsa-miR-509-3-5p	CLIP-seq
MIRT2007406	hsa-miR-509-5p	CLIP-seq
MIRT2007408	hsa-miR-613	CLIP-seq
MIRT2007409	hsa-miR-767-5p	CLIP-seq
MIRT2007394	hsa-miR-1	CLIP-seq
MIRT2240083	hsa-miR-1184	CLIP-seq
MIRT2007399	hsa-miR-206	CLIP-seq
MIRT2240085	hsa-miR-3545-3p	CLIP-seq
MIRT2007401	hsa-miR-3673	CLIP-seq
MIRT2007402	hsa-miR-4418	CLIP-seq
MIRT2007403	hsa-miR-4778-5p	CLIP-seq
MIRT2007405	hsa-miR-509-3-5p	CLIP-seq
MIRT2007406	hsa-miR-509-5p	CLIP-seq
MIRT2007408	hsa-miR-613	CLIP-seq
MIRT2007409	hsa-miR-767-5p	CLIP-seq
MIRT2240084	hsa-miR-122	CLIP-seq
MIRT2543742	hsa-miR-1254	CLIP-seq
MIRT2543743	hsa-miR-3116	CLIP-seq
MIRT2543744	hsa-miR-4258	CLIP-seq
MIRT2543745	hsa-miR-4794	CLIP-seq
MIRT2543746	hsa-miR-661	CLIP-seq
MIRT2543742	hsa-miR-1254	CLIP-seq
MIRT2543743	hsa-miR-3116	CLIP-seq
MIRT2543745	hsa-miR-4794	CLIP-seq
MIRT2543746	hsa-miR-661	CLIP-seq

Transcription factor	Regulation	Reference
AR	Unknown	9238003

34 Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001091	Function	RNA polymerase II general transcription initiation factor binding	IPI	8625415
GO:0001096	Function	TFIIF-class transcription factor complex binding	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005515	Function	Protein binding	IPI	7590250, 7667268, 7854423, 8662660, 9765293, 11183778, 12721286, 12732728, 12737519, 12931194, 24981860, 31467278, 37398436
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IMP	15723517
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005669	Component	Transcription factor TFIID complex	IDA	27193682
GO:0005674	Component	Transcription factor TFIIF complex	IBA
GO:0005674	Component	Transcription factor TFIIF complex	IPI	11183778
GO:0005674	Component	Transcription factor TFIIF complex	TAS	1734283
GO:0006366	Process	Transcription by RNA polymerase II	TAS	1734283, 7854423
GO:0006367	Process	Transcription initiation at RNA polymerase II promoter	IBA
GO:0006367	Process	Transcription initiation at RNA polymerase II promoter	IDA	7929273, 15351637
GO:0006367	Process	Transcription initiation at RNA polymerase II promoter	IEA
GO:0006367	Process	Transcription initiation at RNA polymerase II promoter	TAS	1734284
GO:0006368	Process	Transcription elongation by RNA polymerase II	IDA	15351637
GO:0009615	Process	Response to virus	IEP	16548883
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IBA
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IDA	7929273, 27193682
GO:0019211	Function	Phosphatase activator activity	IDA	12721286
GO:0019903	Function	Protein phosphatase binding	IPI	12732728
GO:0019904	Function	Protein domain specific binding	IPI	15723517
GO:0030054	Component	Cell junction	IDA
GO:0032091	Process	Negative regulation of protein binding	IMP	8662660
GO:0032968	Process	Positive regulation of transcription elongation by RNA polymerase II	IEA
GO:0032991	Component	Protein-containing complex	IMP	12732728
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	15351637
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	8662660
GO:1990841	Function	Promoter-specific chromatin binding	IDA	24441171

MIM	HGNC	e!Ensembl
189968	4652	ENSG00000125651

P35269

Protein name

General transcription factor IIF subunit 1 (General transcription factor IIF 74 kDa subunit) (Transcription initiation factor IIF subunit alpha) (TFIIF-alpha) (Transcription initiation factor RAP74)

Protein function

TFIIF is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation.

PDB

1F3U , 1I27 , 1J2X , 1NHA , 1ONV , 2K7L , 5IY6 , 5IY7 , 5IY8 , 5IY9 , 5IYA , 5IYB , 5IYC , 5IYD , 6O9L , 7EDX , 7EG7 , 7EG8 , 7EG9 , 7EGA , 7EGB , 7EGC , 7ENA , 7ENC , 7LBM , 7NVR , 7NVS , 7NVT , 7NVU , 7NVY , 7NVZ , 7NW0 , 7ZWD , 7ZX7 , 7ZX8 , 8BVW , 8BYQ , 8BZ1 , 8GXQ , 8GXS , 8S51 , 8S52 , 8S54 , 8S55 , 8S5N , 8WAK , 8WAL , 8WAN , 8WAO , 8WAP , 8WAQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05793	TFIIF_alpha	2 → 517	Transcription initiation factor IIF, alpha subunit (TFIIF-alpha)	Family

Sequence

MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEE
EMPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTE
NTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQR
RLKDQDQDEDEEEKEKRGRRKASELRIHDLEDDLEMSSDASDASGEEGGRVPKAKKKAPL
AKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSSSQEEPESKAKAPQQEEGPKG
VDEQSDSSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKDSSEESDSSEESDIDSEASSA
LFMAKKKTPPKRERKPSGGSSRGNSRPGTPSAEGGSTSSTLRAAASKLEQGKRVSEMPAA
KRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTK
KTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE

Sequence length

517

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Basal transcription factors	Formation of RNA Pol II elongation complex
	Formation of the Early Elongation Complex
	Formation of HIV-1 elongation complex containing HIV-1 Tat
	Viral Messenger RNA Synthesis
	RNA Polymerase II Pre-transcription Events
	TP53 Regulates Transcription of DNA Repair Genes
	FGFR2 alternative splicing
	RNA polymerase II transcribes snRNA genes
	mRNA Capping
	mRNA Splicing - Major Pathway
	mRNA Splicing - Minor Pathway
	Processing of Capped Intron-Containing Pre-mRNA
	RNA Polymerase II Promoter Escape
	RNA Polymerase II Transcription Pre-Initiation And Promoter Opening
	RNA Polymerase II Transcription Initiation
	RNA Polymerase II Transcription Elongation
	RNA Polymerase II Transcription Initiation And Promoter Clearance
	RNA Pol II CTD phosphorylation and interaction with CE
	Estrogen-dependent gene expression

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	40708016	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	39046104, 40708016	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	18398031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	18398031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	31185018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	31185018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
GTF2F2	[]	20	["Basal transcription factors","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","mRNA Splicing - Major Pathway","mRNA Splicing - Minor Pathway","Formation of the Early Elongation Complex","RNA polymerase II transcribes snRNA genes","mRNA Capping","RNA Polymerase II Promoter Escape","RNA Polymerase II Transcription Pre-Initiation And Promoter Opening"]	[]
POLR2A	[]	19	["Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","mRNA Splicing - Major Pathway","mRNA Splicing - Minor Pathway","Formation of the Early Elongation Complex","RNA polymerase II transcribes snRNA genes","mRNA Capping","RNA Polymerase II Promoter Escape","RNA Polymerase II Transcription Pre-Initiation And Promoter Opening","RNA Polymerase II Transcription Initiation"]	[]
POLR2B	[]	19	["Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","mRNA Splicing - Major Pathway","mRNA Splicing - Minor Pathway","Formation of the Early Elongation Complex","RNA polymerase II transcribes snRNA genes","mRNA Capping","RNA Polymerase II Promoter Escape","RNA Polymerase II Transcription Pre-Initiation And Promoter Opening","RNA Polymerase II Transcription Initiation"]	[]
POLR2C	[]	19	["Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","mRNA Splicing - Major Pathway","mRNA Splicing - Minor Pathway","Formation of the Early Elongation Complex","RNA polymerase II transcribes snRNA genes","mRNA Capping","RNA Polymerase II Promoter Escape","RNA Polymerase II Transcription Pre-Initiation And Promoter Opening","RNA Polymerase II Transcription Initiation"]	[]
POLR2D	[]	19	["Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","mRNA Splicing - Major Pathway","mRNA Splicing - Minor Pathway","Formation of the Early Elongation Complex","RNA polymerase II transcribes snRNA genes","mRNA Capping","RNA Polymerase II Promoter Escape","RNA Polymerase II Transcription Pre-Initiation And Promoter Opening","RNA Polymerase II Transcription Initiation"]	[]

GTF2F1 (general transcription factor IIF subunit 1)

Bookmark This Gene