GSTT2B (glutathione S-transferase theta 2B)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 653689
Gene name Glutathione S-transferase theta 2B
Gene symbol GSTT2B
Synonyms (NCBI Gene)
GSTT2P
Chromosome 22
Chromosome location 22q11.23
Summary The protein encoded by this gene, glutathione S-transferase (GST) theta 2B (GSTT2B), is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be d
miRNA miRNA information provided by mirtarbase database.
13 Show/Hide all (13)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT029086 hsa-miR-26b-5p Microarray 19088304
MIRT051136 hsa-miR-16-5p CLASH 23622248
MIRT2007356 hsa-miR-3659 CLIP-seq
MIRT2007357 hsa-miR-4658 CLIP-seq
MIRT2007358 hsa-miR-574-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13 Show/Hide all (13)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004364 Function Glutathione transferase activity IBA
GO:0004364 Function Glutathione transferase activity IDA 1417752
GO:0004364 Function Glutathione transferase activity IEA
GO:0004364 Function Glutathione transferase activity NAS 7789971
GO:0005515 Function Protein binding IPI 35156780
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0CG30
Protein name Glutathione S-transferase theta-2B (EC 2.5.1.18) (Glutathione S-transferase theta-2) (GST class-theta-2)
Protein function Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles (PubMed:1417752). Has a sulfatase activity (PubMed:1417752).
PDB 1LJR , 2LJR , 3LJR , 4MPG
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00043 GST_C 83 → 199 Glutathione S-transferase, C-terminal domain Domain
PF02798 GST_N 5 → 75 Glutathione S-transferase, N-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed at low levels in liver. In lung, expressed at low levels in ciliated bronchiolar cells, alveolar macrophages and alveolar type II cells. {ECO:0000269|PubMed:8761485}.
Sequence 
MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDG
DFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLG
PLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALG
YELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRI
ARIP
Sequence length 244
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Glutathione metabolism Glutathione conjugation
Metabolism of xenobiotics by cytochrome P450  
Drug metabolism - cytochrome P450  
Drug metabolism - other enzymes  
Metabolic pathways  
Platinum drug resistance  
Pathways in cancer  
Chemical carcinogenesis - DNA adducts  
Chemical carcinogenesis - receptor activation  
Chemical carcinogenesis - reactive oxygen species  
Hepatocellular carcinoma  
Fluid shear stress and atherosclerosis  
Sort by:
GSTA5 11 shared pathwaysGlutathione metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Platinum drug resistance, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation, Chemical carcinogenesis - reactive oxygen species, Hepatocellular carcinoma, Fluid shear stress and atherosclerosis, Glutathione conjugation Related via 11 shared pathways including Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450. GSTA3 11 shared pathwaysGlutathione metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Platinum drug resistance, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation, Chemical carcinogenesis - reactive oxygen species, Hepatocellular carcinoma, Fluid shear stress and atherosclerosis, Glutathione conjugation Related via 11 shared pathways including Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450. GSTA4 11 shared pathwaysGlutathione metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Platinum drug resistance, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation, Chemical carcinogenesis - reactive oxygen species, Hepatocellular carcinoma, Fluid shear stress and atherosclerosis, Glutathione conjugation Related via 11 shared pathways including Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450. GSTM1 11 shared pathwaysGlutathione metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Platinum drug resistance, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation, Chemical carcinogenesis - reactive oxygen species, Hepatocellular carcinoma, Fluid shear stress and atherosclerosis, Glutathione conjugation Related via 11 shared pathways including Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450. GSTM2 11 shared pathwaysGlutathione metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Platinum drug resistance, Chemical carcinogenesis - DNA adducts, Chemical carcinogenesis - receptor activation, Chemical carcinogenesis - reactive oxygen species, Hepatocellular carcinoma, Fluid shear stress and atherosclerosis, Glutathione conjugation Related via 11 shared pathways including Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450.
Autism Linked via 2 of 5 related genesGSTA3, GSTM1 Parkinson disease Linked via 2 of 5 related genesGSTA4, GSTM1 Breast cancer Linked via 2 of 5 related genesGSTM1, GSTM2 Degenerative disorder Linked via 2 of 5 related genesGSTM1, GSTM2 Kidney failure Linked via 2 of 5 related genesGSTM1, GSTM2