Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	2939
Gene name	Glutathione S-transferase alpha 2
Gene symbol	GSTA2
Synonyms (NCBI Gene)	GST2GSTA2-2GTA2GTH2
Chromosome	6
Chromosome location	6p12.2
Summary	Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and pro

6 Show/Hide all (6)

miRTarBase ID	miRNA	Experiments
MIRT1036471	hsa-miR-4269	CLIP-seq
MIRT1036472	hsa-miR-488	CLIP-seq
MIRT1036473	hsa-miR-513b	CLIP-seq
MIRT2007294	hsa-miR-3148	CLIP-seq
MIRT2007295	hsa-miR-3978	CLIP-seq
MIRT2007296	hsa-miR-432	CLIP-seq

16 Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004364	Function	Glutathione transferase activity	IBA
GO:0004364	Function	Glutathione transferase activity	IEA
GO:0004364	Function	Glutathione transferase activity	ISS
GO:0004364	Function	Glutathione transferase activity	TAS	3138230
GO:0005515	Function	Protein binding	IPI	25416956, 25910212, 28514442, 31515488, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006749	Process	Glutathione metabolic process	IBA
GO:0006749	Process	Glutathione metabolic process	ISS
GO:0006805	Process	Xenobiotic metabolic process	IBA
GO:0016740	Function	Transferase activity	IEA
GO:0030855	Process	Epithelial cell differentiation	IEP	21492153
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070062	Component	Extracellular exosome	TAS

MIM	HGNC	e!Ensembl
138360	4627	ENSG00000244067

P09210

Protein name

Glutathione S-transferase A2 (EC 2.5.1.18) (GST HA subunit 2) (GST class-alpha member 2) (GST-gamma) (GSTA2-2) (GTH2)

Protein function

Catalyzes the conjugation of glutathione to a large variety of electrophilic compounds.

PDB

1AGS , 2VCT , 2WJU , 4ACS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02798	GST_N	5 → 77	Glutathione S-transferase, N-terminal domain	Domain
PF14497	GST_C_3	100 → 201	Glutathione S-transferase, C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Liver. {ECO:0000269|PubMed:3036131}.

Sequence

MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFSQPEEQDAK
LALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF

Sequence length

222

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Glutathione metabolism	Glutathione conjugation
Metabolism of xenobiotics by cytochrome P450	Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis - DNA adducts
Chemical carcinogenesis - receptor activation
Chemical carcinogenesis - reactive oxygen species
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISM SPECTRUM DISORDER	—	CTD	35663546	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	38374256	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (17)
Breast Carcinoma	Breast Carcinoma	BEFREE	19639209, 19859803, 20307559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17259654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19859803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	25798860	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21844655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21844655	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	37385224	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Hemorrhage	Gastrointestinal hemorrhage	Pubtator	35114859	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	9679554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	9679554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19639209, 19859803, 20307559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17259654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19859803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15128049		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19859803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15128049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28586067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
GSTA5	[]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	[]
GSTA3	[]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	[]
GSTA4	[]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	[]
GSTM1	[]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	[]
GSTM2	[]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	[]

GSTA2 (glutathione S-transferase alpha 2)

Save This Analysis