GPX3 (glutathione peroxidase 3)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 2878
• Gene name: Glutathione peroxidase 3
• Gene symbol: GPX3
• Synonyms (NCBI Gene): GPx-P, GSHPx-3, GSHPx-P
• Chromosome: 5
• Chromosome location: 5q33.1
• Summary: The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Several isozy

miRNA Show/Hide all (519)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049503	hsa-miR-92a-3p	CLASH	23622248
MIRT1032505	hsa-let-7a	CLIP-seq
MIRT1032506	hsa-let-7b	CLIP-seq
MIRT1032507	hsa-let-7c	CLIP-seq
MIRT1032508	hsa-let-7d	CLIP-seq
MIRT1032509	hsa-let-7e	CLIP-seq
MIRT1032510	hsa-let-7f	CLIP-seq
MIRT1032511	hsa-let-7g	CLIP-seq
MIRT1032512	hsa-let-7i	CLIP-seq
MIRT1032513	hsa-miR-1227	CLIP-seq
MIRT1032514	hsa-miR-1254	CLIP-seq
MIRT1032515	hsa-miR-1266	CLIP-seq
MIRT1032516	hsa-miR-1321	CLIP-seq
MIRT1032517	hsa-miR-1827	CLIP-seq
MIRT1032518	hsa-miR-1915	CLIP-seq
MIRT1032519	hsa-miR-202	CLIP-seq
MIRT1032520	hsa-miR-2113	CLIP-seq
MIRT1032521	hsa-miR-2278	CLIP-seq
MIRT1032522	hsa-miR-2682	CLIP-seq
MIRT1032523	hsa-miR-3116	CLIP-seq
MIRT1032524	hsa-miR-3121-5p	CLIP-seq
MIRT1032525	hsa-miR-3140-5p	CLIP-seq
MIRT1032526	hsa-miR-324-5p	CLIP-seq
MIRT1032527	hsa-miR-34a	CLIP-seq
MIRT1032528	hsa-miR-34c-5p	CLIP-seq
MIRT1032529	hsa-miR-3612	CLIP-seq
MIRT1032530	hsa-miR-3664-3p	CLIP-seq
MIRT1032531	hsa-miR-3940-5p	CLIP-seq
MIRT1032532	hsa-miR-4270	CLIP-seq
MIRT1032533	hsa-miR-4293	CLIP-seq
MIRT1032534	hsa-miR-4312	CLIP-seq
MIRT1032535	hsa-miR-4441	CLIP-seq
MIRT1032536	hsa-miR-4443	CLIP-seq
MIRT1032537	hsa-miR-4458	CLIP-seq
MIRT1032538	hsa-miR-4487	CLIP-seq
MIRT1032539	hsa-miR-449a	CLIP-seq
MIRT1032540	hsa-miR-449b	CLIP-seq
MIRT1032541	hsa-miR-449c	CLIP-seq
MIRT1032542	hsa-miR-4500	CLIP-seq
MIRT1032543	hsa-miR-4507	CLIP-seq
MIRT1032544	hsa-miR-4518	CLIP-seq
MIRT1032545	hsa-miR-4672	CLIP-seq
MIRT1032546	hsa-miR-4695-3p	CLIP-seq
MIRT1032547	hsa-miR-4704-3p	CLIP-seq
MIRT1032548	hsa-miR-4708-5p	CLIP-seq
MIRT1032549	hsa-miR-4739	CLIP-seq
MIRT1032550	hsa-miR-4756-5p	CLIP-seq
MIRT1032551	hsa-miR-563	CLIP-seq
MIRT1032552	hsa-miR-586	CLIP-seq
MIRT1032553	hsa-miR-596	CLIP-seq
MIRT1032554	hsa-miR-629	CLIP-seq
MIRT1032555	hsa-miR-650	CLIP-seq
MIRT1032556	hsa-miR-661	CLIP-seq
MIRT1032557	hsa-miR-935	CLIP-seq
MIRT1032558	hsa-miR-98	CLIP-seq
MIRT2006298	hsa-miR-1200	CLIP-seq
MIRT2006299	hsa-miR-122	CLIP-seq
MIRT2006300	hsa-miR-2110	CLIP-seq
MIRT1032525	hsa-miR-3140-5p	CLIP-seq
MIRT2006301	hsa-miR-3150a-3p	CLIP-seq
MIRT2006302	hsa-miR-3175	CLIP-seq
MIRT2006303	hsa-miR-3529	CLIP-seq
MIRT2006304	hsa-miR-379	CLIP-seq
MIRT2006305	hsa-miR-4447	CLIP-seq
MIRT2006306	hsa-miR-4451	CLIP-seq
MIRT2006307	hsa-miR-4472	CLIP-seq
MIRT2006308	hsa-miR-4481	CLIP-seq
MIRT2006309	hsa-miR-4536	CLIP-seq
MIRT2006310	hsa-miR-4643	CLIP-seq
MIRT2006311	hsa-miR-4650-3p	CLIP-seq
MIRT2006312	hsa-miR-4659a-3p	CLIP-seq
MIRT2006313	hsa-miR-4659b-3p	CLIP-seq
MIRT2006314	hsa-miR-466	CLIP-seq
MIRT2006315	hsa-miR-4745-5p	CLIP-seq
MIRT2006316	hsa-miR-4789-3p	CLIP-seq
MIRT2006317	hsa-miR-574-5p	CLIP-seq
MIRT2006318	hsa-miR-939	CLIP-seq
MIRT2006300	hsa-miR-2110	CLIP-seq
MIRT2006301	hsa-miR-3150a-3p	CLIP-seq
MIRT2006302	hsa-miR-3175	CLIP-seq
MIRT2006303	hsa-miR-3529	CLIP-seq
MIRT2006304	hsa-miR-379	CLIP-seq
MIRT2006305	hsa-miR-4447	CLIP-seq
MIRT2006307	hsa-miR-4472	CLIP-seq
MIRT2006308	hsa-miR-4481	CLIP-seq
MIRT2006315	hsa-miR-4745-5p	CLIP-seq
MIRT2006318	hsa-miR-939	CLIP-seq
MIRT2006299	hsa-miR-122	CLIP-seq
MIRT1032515	hsa-miR-1266	CLIP-seq
MIRT2388707	hsa-miR-1285	CLIP-seq
MIRT1032516	hsa-miR-1321	CLIP-seq
MIRT2388708	hsa-miR-146a	CLIP-seq
MIRT2388709	hsa-miR-146b-5p	CLIP-seq
MIRT2006300	hsa-miR-2110	CLIP-seq
MIRT2006301	hsa-miR-3150a-3p	CLIP-seq
MIRT2388710	hsa-miR-3151	CLIP-seq
MIRT2006302	hsa-miR-3175	CLIP-seq
MIRT2388711	hsa-miR-3184	CLIP-seq
MIRT2388712	hsa-miR-3187-5p	CLIP-seq
MIRT2388713	hsa-miR-3189-3p	CLIP-seq
MIRT2388714	hsa-miR-342-5p	CLIP-seq
MIRT2388715	hsa-miR-3614-3p	CLIP-seq
MIRT2388716	hsa-miR-3619-3p	CLIP-seq
MIRT1032530	hsa-miR-3664-3p	CLIP-seq
MIRT2388717	hsa-miR-3689a-3p	CLIP-seq
MIRT2388718	hsa-miR-3689c	CLIP-seq
MIRT2388719	hsa-miR-423-5p	CLIP-seq
MIRT1032532	hsa-miR-4270	CLIP-seq
MIRT2388720	hsa-miR-4318	CLIP-seq
MIRT1032535	hsa-miR-4441	CLIP-seq
MIRT2006305	hsa-miR-4447	CLIP-seq
MIRT2388721	hsa-miR-4450	CLIP-seq
MIRT2006307	hsa-miR-4472	CLIP-seq
MIRT2006308	hsa-miR-4481	CLIP-seq
MIRT1032544	hsa-miR-4518	CLIP-seq
MIRT2388722	hsa-miR-4651	CLIP-seq
MIRT2388723	hsa-miR-4664-5p	CLIP-seq
MIRT2388724	hsa-miR-4676-5p	CLIP-seq
MIRT2388725	hsa-miR-4687-3p	CLIP-seq
MIRT1032546	hsa-miR-4695-3p	CLIP-seq
MIRT2388726	hsa-miR-4728-5p	CLIP-seq
MIRT1032549	hsa-miR-4739	CLIP-seq
MIRT2006315	hsa-miR-4745-5p	CLIP-seq
MIRT1032550	hsa-miR-4756-5p	CLIP-seq
MIRT2388727	hsa-miR-4776-5p	CLIP-seq
MIRT2388728	hsa-miR-4800-5p	CLIP-seq
MIRT2388729	hsa-miR-483-5p	CLIP-seq
MIRT2388730	hsa-miR-491-5p	CLIP-seq
MIRT2388731	hsa-miR-513c	CLIP-seq
MIRT2388732	hsa-miR-514b-5p	CLIP-seq
MIRT2388733	hsa-miR-575	CLIP-seq
MIRT2388734	hsa-miR-608	CLIP-seq
MIRT2388735	hsa-miR-612	CLIP-seq
MIRT2388736	hsa-miR-627	CLIP-seq
MIRT2388737	hsa-miR-873	CLIP-seq
MIRT2388738	hsa-miR-924	CLIP-seq
MIRT2006318	hsa-miR-939	CLIP-seq
MIRT1032515	hsa-miR-1266	CLIP-seq
MIRT2442232	hsa-miR-1324	CLIP-seq
MIRT2442233	hsa-miR-24	CLIP-seq
MIRT2442234	hsa-miR-3155	CLIP-seq
MIRT2442235	hsa-miR-3155b	CLIP-seq
MIRT2442236	hsa-miR-3158-3p	CLIP-seq
MIRT2442237	hsa-miR-4438	CLIP-seq
MIRT2442238	hsa-miR-4446-3p	CLIP-seq
MIRT2442239	hsa-miR-4457	CLIP-seq
MIRT2442240	hsa-miR-4492	CLIP-seq
MIRT2442241	hsa-miR-4498	CLIP-seq
MIRT1032544	hsa-miR-4518	CLIP-seq
MIRT2442242	hsa-miR-4749-3p	CLIP-seq
MIRT2442243	hsa-miR-484	CLIP-seq
MIRT2442244	hsa-miR-762	CLIP-seq
MIRT1032505	hsa-let-7a	CLIP-seq
MIRT1032506	hsa-let-7b	CLIP-seq
MIRT1032507	hsa-let-7c	CLIP-seq
MIRT1032508	hsa-let-7d	CLIP-seq
MIRT1032509	hsa-let-7e	CLIP-seq
MIRT1032510	hsa-let-7f	CLIP-seq
MIRT1032511	hsa-let-7g	CLIP-seq
MIRT1032512	hsa-let-7i	CLIP-seq
MIRT2006298	hsa-miR-1200	CLIP-seq
MIRT2542647	hsa-miR-1205	CLIP-seq
MIRT2542648	hsa-miR-1208	CLIP-seq
MIRT2006299	hsa-miR-122	CLIP-seq
MIRT1032513	hsa-miR-1227	CLIP-seq
MIRT1032514	hsa-miR-1254	CLIP-seq
MIRT1032515	hsa-miR-1266	CLIP-seq
MIRT2542649	hsa-miR-1270	CLIP-seq
MIRT2542650	hsa-miR-1273g	CLIP-seq
MIRT1032516	hsa-miR-1321	CLIP-seq
MIRT2442232	hsa-miR-1324	CLIP-seq
MIRT2388708	hsa-miR-146a	CLIP-seq
MIRT2388709	hsa-miR-146b-5p	CLIP-seq
MIRT2542651	hsa-miR-1470	CLIP-seq
MIRT1032517	hsa-miR-1827	CLIP-seq
MIRT2542652	hsa-miR-185	CLIP-seq
MIRT2542653	hsa-miR-1909	CLIP-seq
MIRT2542654	hsa-miR-1912	CLIP-seq
MIRT1032518	hsa-miR-1915	CLIP-seq
MIRT2542655	hsa-miR-196a	CLIP-seq
MIRT2542656	hsa-miR-196b	CLIP-seq
MIRT2542657	hsa-miR-198	CLIP-seq
MIRT1032519	hsa-miR-202	CLIP-seq
MIRT2006300	hsa-miR-2110	CLIP-seq
MIRT1032520	hsa-miR-2113	CLIP-seq
MIRT2542658	hsa-miR-2114	CLIP-seq
MIRT1032521	hsa-miR-2278	CLIP-seq
MIRT2442233	hsa-miR-24	CLIP-seq
MIRT1032522	hsa-miR-2682	CLIP-seq
MIRT2542659	hsa-miR-296-3p	CLIP-seq
MIRT2542660	hsa-miR-296-5p	CLIP-seq
MIRT2542661	hsa-miR-30a	CLIP-seq
MIRT2542662	hsa-miR-30b	CLIP-seq
MIRT2542663	hsa-miR-30c	CLIP-seq
MIRT2542664	hsa-miR-30d	CLIP-seq
MIRT2542665	hsa-miR-30e	CLIP-seq
MIRT1032523	hsa-miR-3116	CLIP-seq
MIRT1032524	hsa-miR-3121-5p	CLIP-seq
MIRT2542666	hsa-miR-3132	CLIP-seq
MIRT2542667	hsa-miR-3138	CLIP-seq
MIRT1032525	hsa-miR-3140-5p	CLIP-seq
MIRT2542668	hsa-miR-3144-5p	CLIP-seq
MIRT2006301	hsa-miR-3150a-3p	CLIP-seq
MIRT2388710	hsa-miR-3151	CLIP-seq
MIRT2442234	hsa-miR-3155	CLIP-seq
MIRT2442235	hsa-miR-3155b	CLIP-seq
MIRT2442236	hsa-miR-3158-3p	CLIP-seq
MIRT2542669	hsa-miR-3165	CLIP-seq
MIRT2542670	hsa-miR-3167	CLIP-seq
MIRT2006302	hsa-miR-3175	CLIP-seq
MIRT2388713	hsa-miR-3189-3p	CLIP-seq
MIRT2542671	hsa-miR-3191	CLIP-seq
MIRT2542672	hsa-miR-3198	CLIP-seq
MIRT2542673	hsa-miR-323b-5p	CLIP-seq
MIRT1032526	hsa-miR-324-5p	CLIP-seq
MIRT2542674	hsa-miR-338-3p	CLIP-seq
MIRT2388714	hsa-miR-342-5p	CLIP-seq
MIRT1032527	hsa-miR-34a	CLIP-seq
MIRT1032528	hsa-miR-34c-5p	CLIP-seq
MIRT2006303	hsa-miR-3529	CLIP-seq
MIRT1032529	hsa-miR-3612	CLIP-seq
MIRT2388715	hsa-miR-3614-3p	CLIP-seq
MIRT1032530	hsa-miR-3664-3p	CLIP-seq
MIRT2388717	hsa-miR-3689a-3p	CLIP-seq
MIRT2388718	hsa-miR-3689c	CLIP-seq
MIRT2006304	hsa-miR-379	CLIP-seq
MIRT2542675	hsa-miR-3927	CLIP-seq
MIRT2542676	hsa-miR-3935	CLIP-seq
MIRT2542677	hsa-miR-3936	CLIP-seq
MIRT1032531	hsa-miR-3940-5p	CLIP-seq
MIRT2542678	hsa-miR-4269	CLIP-seq
MIRT1032532	hsa-miR-4270	CLIP-seq
MIRT1032533	hsa-miR-4293	CLIP-seq
MIRT2542679	hsa-miR-4306	CLIP-seq
MIRT2542680	hsa-miR-4309	CLIP-seq
MIRT1032534	hsa-miR-4312	CLIP-seq
MIRT2542681	hsa-miR-4314	CLIP-seq
MIRT2388720	hsa-miR-4318	CLIP-seq
MIRT2542682	hsa-miR-4434	CLIP-seq
MIRT2442237	hsa-miR-4438	CLIP-seq
MIRT1032535	hsa-miR-4441	CLIP-seq
MIRT1032536	hsa-miR-4443	CLIP-seq
MIRT2442238	hsa-miR-4446-3p	CLIP-seq
MIRT2006305	hsa-miR-4447	CLIP-seq
MIRT2388721	hsa-miR-4450	CLIP-seq
MIRT2006306	hsa-miR-4451	CLIP-seq
MIRT2442239	hsa-miR-4457	CLIP-seq
MIRT1032537	hsa-miR-4458	CLIP-seq
MIRT2542683	hsa-miR-4462	CLIP-seq
MIRT2542684	hsa-miR-4468	CLIP-seq
MIRT2542685	hsa-miR-4469	CLIP-seq
MIRT2006307	hsa-miR-4472	CLIP-seq
MIRT2006308	hsa-miR-4481	CLIP-seq
MIRT1032538	hsa-miR-4487	CLIP-seq
MIRT2442240	hsa-miR-4492	CLIP-seq
MIRT2542686	hsa-miR-4496	CLIP-seq
MIRT2442241	hsa-miR-4498	CLIP-seq
MIRT1032539	hsa-miR-449a	CLIP-seq
MIRT1032540	hsa-miR-449b	CLIP-seq
MIRT1032541	hsa-miR-449c	CLIP-seq
MIRT1032542	hsa-miR-4500	CLIP-seq
MIRT2542687	hsa-miR-4505	CLIP-seq
MIRT1032543	hsa-miR-4507	CLIP-seq
MIRT2542688	hsa-miR-4516	CLIP-seq
MIRT1032544	hsa-miR-4518	CLIP-seq
MIRT2542689	hsa-miR-4530	CLIP-seq
MIRT2542690	hsa-miR-4531	CLIP-seq
MIRT2542691	hsa-miR-4535	CLIP-seq
MIRT2006309	hsa-miR-4536	CLIP-seq
MIRT2542692	hsa-miR-4642	CLIP-seq
MIRT2006310	hsa-miR-4643	CLIP-seq
MIRT2542693	hsa-miR-4644	CLIP-seq
MIRT2006311	hsa-miR-4650-3p	CLIP-seq
MIRT2388722	hsa-miR-4651	CLIP-seq
MIRT2542694	hsa-miR-4652-5p	CLIP-seq
MIRT2542695	hsa-miR-4658	CLIP-seq
MIRT2006312	hsa-miR-4659a-3p	CLIP-seq
MIRT2542696	hsa-miR-4659a-5p	CLIP-seq
MIRT2006313	hsa-miR-4659b-3p	CLIP-seq
MIRT2542697	hsa-miR-4659b-5p	CLIP-seq
MIRT2006314	hsa-miR-466	CLIP-seq
MIRT2388723	hsa-miR-4664-5p	CLIP-seq
MIRT2542698	hsa-miR-4667-3p	CLIP-seq
MIRT2542699	hsa-miR-4667-5p	CLIP-seq
MIRT2542700	hsa-miR-4671-5p	CLIP-seq
MIRT1032545	hsa-miR-4672	CLIP-seq
MIRT2542701	hsa-miR-4677-3p	CLIP-seq
MIRT2542702	hsa-miR-4679	CLIP-seq
MIRT2388725	hsa-miR-4687-3p	CLIP-seq
MIRT1032546	hsa-miR-4695-3p	CLIP-seq
MIRT2542703	hsa-miR-4700-5p	CLIP-seq
MIRT1032547	hsa-miR-4704-3p	CLIP-seq
MIRT2542704	hsa-miR-4705	CLIP-seq
MIRT1032548	hsa-miR-4708-5p	CLIP-seq
MIRT2542705	hsa-miR-4718	CLIP-seq
MIRT2542706	hsa-miR-4722-3p	CLIP-seq
MIRT2388726	hsa-miR-4728-5p	CLIP-seq
MIRT2542707	hsa-miR-4731-5p	CLIP-seq
MIRT1032549	hsa-miR-4739	CLIP-seq
MIRT2006315	hsa-miR-4745-5p	CLIP-seq
MIRT2442242	hsa-miR-4749-3p	CLIP-seq
MIRT2542708	hsa-miR-4755-3p	CLIP-seq
MIRT1032550	hsa-miR-4756-5p	CLIP-seq
MIRT2542709	hsa-miR-4758-5p	CLIP-seq
MIRT2542710	hsa-miR-4765	CLIP-seq
MIRT2542711	hsa-miR-4769-3p	CLIP-seq
MIRT2388727	hsa-miR-4776-5p	CLIP-seq
MIRT2006316	hsa-miR-4789-3p	CLIP-seq
MIRT2542712	hsa-miR-4802-3p	CLIP-seq
MIRT2442243	hsa-miR-484	CLIP-seq
MIRT2388730	hsa-miR-491-5p	CLIP-seq
MIRT2542713	hsa-miR-492	CLIP-seq
MIRT2542714	hsa-miR-501-3p	CLIP-seq
MIRT2542715	hsa-miR-502-3p	CLIP-seq
MIRT1032551	hsa-miR-563	CLIP-seq
MIRT2006317	hsa-miR-574-5p	CLIP-seq
MIRT1032552	hsa-miR-586	CLIP-seq
MIRT1032553	hsa-miR-596	CLIP-seq
MIRT2388734	hsa-miR-608	CLIP-seq
MIRT2542716	hsa-miR-615-5p	CLIP-seq
MIRT2542717	hsa-miR-620	CLIP-seq
MIRT1032554	hsa-miR-629	CLIP-seq
MIRT2542718	hsa-miR-637	CLIP-seq
MIRT2542719	hsa-miR-642b	CLIP-seq
MIRT2542720	hsa-miR-648	CLIP-seq
MIRT1032555	hsa-miR-650	CLIP-seq
MIRT1032556	hsa-miR-661	CLIP-seq
MIRT2542721	hsa-miR-668	CLIP-seq
MIRT2442244	hsa-miR-762	CLIP-seq
MIRT2388737	hsa-miR-873	CLIP-seq
MIRT2542722	hsa-miR-876-5p	CLIP-seq
MIRT1032557	hsa-miR-935	CLIP-seq
MIRT2006318	hsa-miR-939	CLIP-seq
MIRT1032558	hsa-miR-98	CLIP-seq
MIRT1032505	hsa-let-7a	CLIP-seq
MIRT1032506	hsa-let-7b	CLIP-seq
MIRT1032507	hsa-let-7c	CLIP-seq
MIRT1032508	hsa-let-7d	CLIP-seq
MIRT1032509	hsa-let-7e	CLIP-seq
MIRT1032510	hsa-let-7f	CLIP-seq
MIRT1032511	hsa-let-7g	CLIP-seq
MIRT1032512	hsa-let-7i	CLIP-seq
MIRT2006298	hsa-miR-1200	CLIP-seq
MIRT2682061	hsa-miR-1204	CLIP-seq
MIRT2542647	hsa-miR-1205	CLIP-seq
MIRT2542648	hsa-miR-1208	CLIP-seq
MIRT2006299	hsa-miR-122	CLIP-seq
MIRT1032513	hsa-miR-1227	CLIP-seq
MIRT1032514	hsa-miR-1254	CLIP-seq
MIRT1032515	hsa-miR-1266	CLIP-seq
MIRT2542649	hsa-miR-1270	CLIP-seq
MIRT2542650	hsa-miR-1273g	CLIP-seq
MIRT2682062	hsa-miR-1291	CLIP-seq
MIRT1032516	hsa-miR-1321	CLIP-seq
MIRT2442232	hsa-miR-1324	CLIP-seq
MIRT2388708	hsa-miR-146a	CLIP-seq
MIRT2388709	hsa-miR-146b-5p	CLIP-seq
MIRT2542651	hsa-miR-1470	CLIP-seq
MIRT1032517	hsa-miR-1827	CLIP-seq
MIRT2542652	hsa-miR-185	CLIP-seq
MIRT2542653	hsa-miR-1909	CLIP-seq
MIRT2542654	hsa-miR-1912	CLIP-seq
MIRT1032518	hsa-miR-1915	CLIP-seq
MIRT2542655	hsa-miR-196a	CLIP-seq
MIRT2542656	hsa-miR-196b	CLIP-seq
MIRT2542657	hsa-miR-198	CLIP-seq
MIRT1032519	hsa-miR-202	CLIP-seq
MIRT2006300	hsa-miR-2110	CLIP-seq
MIRT1032520	hsa-miR-2113	CLIP-seq
MIRT2542658	hsa-miR-2114	CLIP-seq
MIRT1032521	hsa-miR-2278	CLIP-seq
MIRT2442233	hsa-miR-24	CLIP-seq
MIRT1032522	hsa-miR-2682	CLIP-seq
MIRT2542659	hsa-miR-296-3p	CLIP-seq
MIRT2542660	hsa-miR-296-5p	CLIP-seq
MIRT2542661	hsa-miR-30a	CLIP-seq
MIRT2542662	hsa-miR-30b	CLIP-seq
MIRT2542663	hsa-miR-30c	CLIP-seq
MIRT2542664	hsa-miR-30d	CLIP-seq
MIRT2542665	hsa-miR-30e	CLIP-seq
MIRT1032523	hsa-miR-3116	CLIP-seq
MIRT1032524	hsa-miR-3121-5p	CLIP-seq
MIRT2542666	hsa-miR-3132	CLIP-seq
MIRT1032525	hsa-miR-3140-5p	CLIP-seq
MIRT2542668	hsa-miR-3144-5p	CLIP-seq
MIRT2006301	hsa-miR-3150a-3p	CLIP-seq
MIRT2388710	hsa-miR-3151	CLIP-seq
MIRT2442234	hsa-miR-3155	CLIP-seq
MIRT2442235	hsa-miR-3155b	CLIP-seq
MIRT2442236	hsa-miR-3158-3p	CLIP-seq
MIRT2542669	hsa-miR-3165	CLIP-seq
MIRT2542670	hsa-miR-3167	CLIP-seq
MIRT2006302	hsa-miR-3175	CLIP-seq
MIRT2388713	hsa-miR-3189-3p	CLIP-seq
MIRT2542671	hsa-miR-3191	CLIP-seq
MIRT2542672	hsa-miR-3198	CLIP-seq
MIRT2542673	hsa-miR-323b-5p	CLIP-seq
MIRT1032526	hsa-miR-324-5p	CLIP-seq
MIRT2682063	hsa-miR-328	CLIP-seq
MIRT2542674	hsa-miR-338-3p	CLIP-seq
MIRT2388714	hsa-miR-342-5p	CLIP-seq
MIRT1032527	hsa-miR-34a	CLIP-seq
MIRT1032528	hsa-miR-34c-5p	CLIP-seq
MIRT2006303	hsa-miR-3529	CLIP-seq
MIRT1032529	hsa-miR-3612	CLIP-seq
MIRT2388715	hsa-miR-3614-3p	CLIP-seq
MIRT1032530	hsa-miR-3664-3p	CLIP-seq
MIRT2388717	hsa-miR-3689a-3p	CLIP-seq
MIRT2388718	hsa-miR-3689c	CLIP-seq
MIRT2006304	hsa-miR-379	CLIP-seq
MIRT2542675	hsa-miR-3927	CLIP-seq
MIRT2542676	hsa-miR-3935	CLIP-seq
MIRT2542677	hsa-miR-3936	CLIP-seq
MIRT1032531	hsa-miR-3940-5p	CLIP-seq
MIRT2542678	hsa-miR-4269	CLIP-seq
MIRT1032532	hsa-miR-4270	CLIP-seq
MIRT1032533	hsa-miR-4293	CLIP-seq
MIRT2542679	hsa-miR-4306	CLIP-seq
MIRT2542680	hsa-miR-4309	CLIP-seq
MIRT1032534	hsa-miR-4312	CLIP-seq
MIRT2542681	hsa-miR-4314	CLIP-seq
MIRT2388720	hsa-miR-4318	CLIP-seq
MIRT2542682	hsa-miR-4434	CLIP-seq
MIRT2442237	hsa-miR-4438	CLIP-seq
MIRT1032535	hsa-miR-4441	CLIP-seq
MIRT1032536	hsa-miR-4443	CLIP-seq
MIRT2442238	hsa-miR-4446-3p	CLIP-seq
MIRT2006305	hsa-miR-4447	CLIP-seq
MIRT2388721	hsa-miR-4450	CLIP-seq
MIRT2006306	hsa-miR-4451	CLIP-seq
MIRT2442239	hsa-miR-4457	CLIP-seq
MIRT1032537	hsa-miR-4458	CLIP-seq
MIRT2542683	hsa-miR-4462	CLIP-seq
MIRT2542684	hsa-miR-4468	CLIP-seq
MIRT2542685	hsa-miR-4469	CLIP-seq
MIRT2006307	hsa-miR-4472	CLIP-seq
MIRT2006308	hsa-miR-4481	CLIP-seq
MIRT1032538	hsa-miR-4487	CLIP-seq
MIRT2442240	hsa-miR-4492	CLIP-seq
MIRT2542686	hsa-miR-4496	CLIP-seq
MIRT2442241	hsa-miR-4498	CLIP-seq
MIRT1032539	hsa-miR-449a	CLIP-seq
MIRT1032540	hsa-miR-449b	CLIP-seq
MIRT1032541	hsa-miR-449c	CLIP-seq
MIRT1032542	hsa-miR-4500	CLIP-seq
MIRT2542687	hsa-miR-4505	CLIP-seq
MIRT1032543	hsa-miR-4507	CLIP-seq
MIRT2542688	hsa-miR-4516	CLIP-seq
MIRT1032544	hsa-miR-4518	CLIP-seq
MIRT2542689	hsa-miR-4530	CLIP-seq
MIRT2542690	hsa-miR-4531	CLIP-seq
MIRT2542691	hsa-miR-4535	CLIP-seq
MIRT2006309	hsa-miR-4536	CLIP-seq
MIRT2542692	hsa-miR-4642	CLIP-seq
MIRT2006310	hsa-miR-4643	CLIP-seq
MIRT2542693	hsa-miR-4644	CLIP-seq
MIRT2006311	hsa-miR-4650-3p	CLIP-seq
MIRT2388722	hsa-miR-4651	CLIP-seq
MIRT2542694	hsa-miR-4652-5p	CLIP-seq
MIRT2542695	hsa-miR-4658	CLIP-seq
MIRT2006312	hsa-miR-4659a-3p	CLIP-seq
MIRT2542696	hsa-miR-4659a-5p	CLIP-seq
MIRT2006313	hsa-miR-4659b-3p	CLIP-seq
MIRT2542697	hsa-miR-4659b-5p	CLIP-seq
MIRT2006314	hsa-miR-466	CLIP-seq
MIRT2388723	hsa-miR-4664-5p	CLIP-seq
MIRT2542698	hsa-miR-4667-3p	CLIP-seq
MIRT2542699	hsa-miR-4667-5p	CLIP-seq
MIRT2542700	hsa-miR-4671-5p	CLIP-seq
MIRT1032545	hsa-miR-4672	CLIP-seq
MIRT2542701	hsa-miR-4677-3p	CLIP-seq
MIRT2542702	hsa-miR-4679	CLIP-seq
MIRT2388725	hsa-miR-4687-3p	CLIP-seq
MIRT1032546	hsa-miR-4695-3p	CLIP-seq
MIRT2542703	hsa-miR-4700-5p	CLIP-seq
MIRT1032547	hsa-miR-4704-3p	CLIP-seq
MIRT2542704	hsa-miR-4705	CLIP-seq
MIRT1032548	hsa-miR-4708-5p	CLIP-seq
MIRT2542705	hsa-miR-4718	CLIP-seq
MIRT2542706	hsa-miR-4722-3p	CLIP-seq
MIRT2388726	hsa-miR-4728-5p	CLIP-seq
MIRT2542707	hsa-miR-4731-5p	CLIP-seq
MIRT1032549	hsa-miR-4739	CLIP-seq
MIRT2006315	hsa-miR-4745-5p	CLIP-seq
MIRT2442242	hsa-miR-4749-3p	CLIP-seq
MIRT2542708	hsa-miR-4755-3p	CLIP-seq
MIRT1032550	hsa-miR-4756-5p	CLIP-seq
MIRT2542709	hsa-miR-4758-5p	CLIP-seq
MIRT2542710	hsa-miR-4765	CLIP-seq
MIRT2542711	hsa-miR-4769-3p	CLIP-seq
MIRT2388727	hsa-miR-4776-5p	CLIP-seq
MIRT2006316	hsa-miR-4789-3p	CLIP-seq
MIRT2542712	hsa-miR-4802-3p	CLIP-seq
MIRT2442243	hsa-miR-484	CLIP-seq
MIRT2388730	hsa-miR-491-5p	CLIP-seq
MIRT2542713	hsa-miR-492	CLIP-seq
MIRT2542714	hsa-miR-501-3p	CLIP-seq
MIRT2542715	hsa-miR-502-3p	CLIP-seq
MIRT1032551	hsa-miR-563	CLIP-seq
MIRT2006317	hsa-miR-574-5p	CLIP-seq
MIRT1032552	hsa-miR-586	CLIP-seq
MIRT1032553	hsa-miR-596	CLIP-seq
MIRT2388734	hsa-miR-608	CLIP-seq
MIRT2542716	hsa-miR-615-5p	CLIP-seq
MIRT2542717	hsa-miR-620	CLIP-seq
MIRT1032554	hsa-miR-629	CLIP-seq
MIRT2542718	hsa-miR-637	CLIP-seq
MIRT2542719	hsa-miR-642b	CLIP-seq
MIRT2542720	hsa-miR-648	CLIP-seq
MIRT1032555	hsa-miR-650	CLIP-seq
MIRT1032556	hsa-miR-661	CLIP-seq
MIRT2682064	hsa-miR-663b	CLIP-seq
MIRT2542721	hsa-miR-668	CLIP-seq
MIRT2442244	hsa-miR-762	CLIP-seq
MIRT2388737	hsa-miR-873	CLIP-seq
MIRT2542722	hsa-miR-876-5p	CLIP-seq
MIRT1032557	hsa-miR-935	CLIP-seq
MIRT2006318	hsa-miR-939	CLIP-seq
MIRT1032558	hsa-miR-98	CLIP-seq

Gene ontology (GO) Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004601	Function	Peroxidase activity	IEA
GO:0004602	Function	Glutathione peroxidase activity	IBA
GO:0004602	Function	Glutathione peroxidase activity	IDA	1897960, 3693360
GO:0004602	Function	Glutathione peroxidase activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	1897960
GO:0006979	Process	Response to oxidative stress	IEA
GO:0006982	Process	Response to lipid hydroperoxide	TAS	2491950
GO:0008430	Function	Selenium binding	IBA
GO:0008430	Function	Selenium binding	IDA	2491950, 3693360
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0042744	Process	Hydrogen peroxide catabolic process	IBA
GO:0042744	Process	Hydrogen peroxide catabolic process	IEA
GO:0042744	Process	Hydrogen peroxide catabolic process	TAS	2491950
GO:0042802	Function	Identical protein binding	IPI	3693360
GO:0070062	Component	Extracellular exosome	HDA	19199708, 23533145
GO:0098869	Process	Cellular oxidant detoxification	IEA

Other IDs

• MIM: 138321
• HGNC: 4555
• e!Ensembl: ENSG00000211445

Protein

• UniProt ID: P22352
• Protein name: Glutathione peroxidase 3 (GPx-3) (GSHPx-3) (EC 1.11.1.9) (Extracellular glutathione peroxidase) (Plasma glutathione peroxidase) (GPx-P) (GSHPx-P)
• Protein function: Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione.
• PDB: 2R37
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00255	GSHPx	40 → 153	Glutathione peroxidase	Family

• Tissue specificity: TISSUE SPECIFICITY: Secreted in plasma.
• Sequence:

  MARLLQASCLLSLLLAGFVSQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYA
  GKYVLFVNVASYUGLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLK
  YVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGTSDRLFWEPMKVHDIR
  WNFEKFLVGPDGIPIMRWHHRTTVSNVKMDILSYMRRQAALGVKRK

• Sequence length: 226

Pathways

KEGG Pathway	Reactome Pathway
Glutathione metabolism	Detoxification of Reactive Oxygen Species
Metabolic pathways
Thyroid hormone synthesis
Amyotrophic lateral sclerosis
Huntington disease
Pathways of neurodegeneration - multiple diseases

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (17)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	40645996	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BARRETT ESOPHAGUS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL INFARCTION	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DEFECTS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEGENERATIVE DISORDER	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	20864642, 21063030	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FANCONI SYNDROME	—	CTD, Disgenet CTD, Disgenet	9851889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	39792054	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	19270708	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	20195826	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	19180532, 21552421	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISEASES	—	CTD	15964507	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISORDERS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	11328671, 19270708	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	17804715	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (191)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	16229808, 24014049, 24167362, 30114685		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	16229808		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	LHGDN	19020706		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Adult Fanconi syndrome	Fanconi syndrome	CTD_human_DG	9851889		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	15375613		★☆☆☆☆ Found in Text Mining only
Alveolitis Extrinsic Allergic	Extrinsic allergic alveolitis	Pubtator	37800807	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	23436019, 28931804		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	33541344, 37328865	Associate	★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	17122425, 20946167		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	39389271	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	39389271	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	37087463	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11149894		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	15038835, 35858526	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	32197906	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Barrett Esophagus	Barrett esophagus	BEFREE	16229808, 18664505, 27415609		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Barrett Esophagus	Barrett esophagus	LHGDN	16229808		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Barrett Esophagus	Barrett esophagus	Pubtator	16229808	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Barrett Esophagus	Barrett esophagus	Pubtator	18664505	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	21684681		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	20712757		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	34387669, 36476443	Associate	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	37790850	Associate	★☆☆☆☆ Found in Text Mining only
Bowen's Disease	Bowen’s disease	Pubtator	36085041	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	1339300, 24278290, 24790704, 24926085		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24278290	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37923090	Inhibit	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	37751795	Associate	★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	18664505		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16229808	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25970749, 37790850	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	23071548, 24926085, 26232338		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27965980	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27484907, 30260967, 30898707		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25970749, 32316597	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36085041, 40179422	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30509602		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	29244159		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	24790704		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	11934214		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	25923078	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29244159		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	31814699	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	17122425, 20946167, 28738977	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	BEFREE	10446087, 22158110		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	24788695		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	24788695		★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	29187474		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	29187474		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29244159		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30118830		★☆☆☆☆ Found in Text Mining only
Classical phenylketonuria	Phenylketonuria	BEFREE	27742442		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22371331, 26682223		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	34564978, 38179743	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27918237		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34364366, 36105798, 37664836	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25970749		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30600457, 31396447		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30600457		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	30600457		★☆☆☆☆ Found in Text Mining only
Coronary Thrombosis	Coronary Thrombosis	BEFREE	29244159		★☆☆☆☆ Found in Text Mining only
De Toni-Debre-Fanconi Syndrome	Fanconi Syndrome	CTD_human_DG	9851889		★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Central Nervous System	Degenerative Diseases, Central Nervous System	CTD_human_DG	15964507		★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Spinal Cord	Degenerative Diseases, Central Nervous System	CTD_human_DG	15964507		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	37328865	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	LHGDN	18936159		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	37537394	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	25923078, 30537708, 32049633	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	21962117		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29383971, 30537708, 30725267, 31817851		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	34545296	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	31102503		★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	19375609		★☆☆☆☆ Found in Text Mining only
Disorder of macula of retina	Disorder Of Macula Of Retina	BEFREE	15375613		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	10624550		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	20864642, 21063030		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	20864642, 21063030		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	39408909	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25050929	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	21933611, 22158110		★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	15375613		★☆☆☆☆ Found in Text Mining only
Fanconi Syndrome	Fanconi Syndrome	CTD_human_DG	9851889		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fanconi-Bickel Syndrome	Fanconi-Bickel Syndrome	CTD_human_DG	9851889		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	24167362	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	23778325	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	20530493		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	20530493		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	36768762	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	28087172		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	21684681		★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	28738977	Associate	★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	26612412	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	29244159		★☆☆☆☆ Found in Text Mining only
Hemoglobin SC Disease	Hemoglobin sc disease	Pubtator	24167362	Associate	★☆☆☆☆ Found in Text Mining only
Hyperphenylalaninaemia	Hyperphenylalaninemia	BEFREE	27742442		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	21933611		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	24790704		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	30537708	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intracranial Thrombosis	Intracranial thrombosis	Pubtator	28738977	Associate	★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	24790704		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	17122425, 18096833, 20946167, 25126700, 28738977		★☆☆☆☆ Found in Text Mining only
Kashin-Beck Disease	Kashin-Beck Disease	BEFREE	30153510		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	21962117, 29244159, 31817851		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	22508837, 27891827		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	27891827	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	26045745, 27891827, 33369453	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	33202543	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26045745, 27891827		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	1339300, 25333265, 25445749		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	CTD_human_DG	20195826		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	BEFREE	11149894		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	19180532, 21552421		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	19887610, 23374247, 27484907, 30260967	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23071548	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24167362	Associate	★☆☆☆☆ Found in Text Mining only
Macular degeneration	Macular Degeneration	BEFREE	15375613		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	28651595	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	21684681		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	1339300, 24278290, 24790704, 25929866		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	24167362		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	20195826		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	19180532, 21552421		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27484907, 30260967, 30898707		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30509602		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17804715, 21374652, 22461624, 23143801, 25929866, 30250621		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17804715		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20043075, 20576521, 22843889, 30924352		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	25929866		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20043075, 21684681, 22461624, 23071548, 24788695, 24790704, 26682223, 27891827, 29187474, 30509602, 30898707, 31085009		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	21684681		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	24788695		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22371331, 26682223		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	30887279		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	20043075, 27600457, 31310363		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	31310363		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	24819036		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	7398093		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	23339595, 27891827		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	23339595, 27891827, 32967500	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	26261521		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	36553589	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11358798, 17804715, 19289149, 22461624, 24014049, 25333265, 25445749, 25929866, 25970749, 27484907, 27600457, 27918237, 30018730, 30260967, 30509602, 31085009		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	21684681		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	CTD_human_DG	15964507		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31352088		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	CTD_human_DG	11328671, 19270708		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	18562625, 30537708		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	30537708	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	17075858	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	33455417	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30509602		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	30509602, 38299269	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34660806	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	25929866		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	31199560	Associate	★☆☆☆☆ Found in Text Mining only
Poikiloderma with Neutropenia	Poikiloderma With Neutropenia	BEFREE	25050929		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	24279306, 30999628		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	24279306, 36246893	Associate	★☆☆☆☆ Found in Text Mining only
Propionic acidemia	Propionic acidemia	BEFREE	30753843		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17804715, 21374652, 22461624, 23143801, 25929866, 30250621		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15899813, 23143801, 24769028, 25284284, 31115550	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17804715		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	27364786	Associate	★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	22371331		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	1339300		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	1339300		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	27297950	Stimulate	★☆☆☆☆ Found in Text Mining only
secondary acute myeloid leukemia	Myeloid leukemia	BEFREE	27891827		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	39438952	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29100971		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	20725785, 30018730, 31610903		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29802697, 33545567	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20043075, 20576521, 22843889, 30924352		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23071548	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24014049, 30114685, 34773716, 34840985, 35601155, 37790850, 38042786, 39527470, 39762768	Associate	★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	29155971		★☆☆☆☆ Found in Text Mining only
Thromboembolic stroke	Thromboembolic stroke	BEFREE	20946167		★☆☆☆☆ Found in Text Mining only
Thrombosis of cerebral veins	Thrombosis	BEFREE	18096833, 28738977		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	25929866		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	17937619		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	25929866		★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	10446087		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	10446087		★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	27742707	Associate	★☆☆☆☆ Found in Text Mining only
Vertical Talus	Vertical Talus	BEFREE	18096833		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

GPX7 1 shared diseaseBarrett esophagus 3 shared pathwaysGlutathione metabolism, Thyroid hormone synthesis, Detoxification of Reactive Oxygen Species 1 shared evidence sourceDisgenet (Barrett esophagus) Related via 3 shared pathways including Glutathione metabolism, Thyroid hormone synthesis — evidence mostly Disgenet. GPX6 3 shared pathwaysGlutathione metabolism, Thyroid hormone synthesis, Detoxification of Reactive Oxygen Species Related via 3 shared pathways including Glutathione metabolism, Thyroid hormone synthesis. GPX5 3 shared pathwaysGlutathione metabolism, Thyroid hormone synthesis, Detoxification of Reactive Oxygen Species Related via 3 shared pathways including Glutathione metabolism, Thyroid hormone synthesis. GPX8 3 shared pathwaysGlutathione metabolism, Thyroid hormone synthesis, Detoxification of Reactive Oxygen Species Related via 3 shared pathways including Glutathione metabolism, Thyroid hormone synthesis. IDO1 2 shared diseasesDegenerative disorder, Neurodegenerative disorder 7 shared evidence sourcesDisgenet (Obesity), Disgenet (Degenerative disorder), CTD (Endometriosis), Disgenet (Endometriosis), CTD (Neurodegenerative disorder), Disgenet (Neurodegenerative disorder), CTD (Obesity) Related via 2 shared diseases including Degenerative disorder, Neurodegenerative disorder — evidence mostly Disgenet.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
GPX7	1	["Barrett esophagus"]	3	["Glutathione metabolism","Thyroid hormone synthesis","Detoxification of Reactive Oxygen Species"]	1	["Disgenet (Barrett esophagus)"]
GPX6	0	[]	3	["Glutathione metabolism","Thyroid hormone synthesis","Detoxification of Reactive Oxygen Species"]	0	[]
GPX5	0	[]	3	["Glutathione metabolism","Thyroid hormone synthesis","Detoxification of Reactive Oxygen Species"]	0	[]
GPX8	0	[]	3	["Glutathione metabolism","Thyroid hormone synthesis","Detoxification of Reactive Oxygen Species"]	0	[]
IDO1	2	["Degenerative disorder","Neurodegenerative disorder"]	0	[]	7	["Disgenet (Obesity)","Disgenet (Degenerative disorder)","CTD (Endometriosis)","Disgenet (Endometriosis)","CTD (Neurodegenerative disorder)","Disgenet (Neurodegenerative disorder)","CTD (Obesity)"]

Diseases Linked via Similar Genes

Autism Linked via 2 of 5 related genesGPX6, GPX5 Bipolar disorder Linked via 2 of 5 related genesGPX6, GPX5 Major depressive disorder Linked via 2 of 5 related genesGPX6, IDO1 Breast cancer Linked via 1 of 5 related genesGPX6 Epithelial ovarian carcinoma Linked via 1 of 5 related genesGPX6

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Autism	2	["GPX6","GPX5"]
Bipolar disorder	2	["GPX6","GPX5"]
Major depressive disorder	2	["GPX6","IDO1"]
Breast cancer	1	["GPX6"]
Epithelial ovarian carcinoma	1	["GPX6"]