GPX2 (glutathione peroxidase 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 2877
• Gene name: Glutathione peroxidase 2
• Gene symbol: GPX2
• Synonyms (NCBI Gene): GI-GPx, GPRP, GPRP-2, GPx-2, GPx-GI, GSHPX-GI, GSHPx-2
• Chromosome: 14
• Chromosome location: 14q23.3
• Summary: The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Several isozy

miRNA Show/Hide all (17)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005746	hsa-miR-17-3p	Luciferase reporter assay, Quantitative proteomic approach, Western blot	21203553
MIRT018920	hsa-miR-335-5p	Microarray	18185580
MIRT1032490	hsa-miR-1193	CLIP-seq
MIRT1032491	hsa-miR-1243	CLIP-seq
MIRT1032492	hsa-miR-1976	CLIP-seq
MIRT1032493	hsa-miR-3140-5p	CLIP-seq
MIRT1032494	hsa-miR-3169	CLIP-seq
MIRT1032495	hsa-miR-324-5p	CLIP-seq
MIRT1032496	hsa-miR-338-3p	CLIP-seq
MIRT1032497	hsa-miR-3664-3p	CLIP-seq
MIRT1032498	hsa-miR-3910	CLIP-seq
MIRT1032499	hsa-miR-4268	CLIP-seq
MIRT1032500	hsa-miR-4436a	CLIP-seq
MIRT1032501	hsa-miR-4493	CLIP-seq
MIRT1032502	hsa-miR-4515	CLIP-seq
MIRT1032503	hsa-miR-4519	CLIP-seq
MIRT1032504	hsa-miR-4530	CLIP-seq

Gene ontology (GO) Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004601	Function	Peroxidase activity	IEA
GO:0004602	Function	Glutathione peroxidase activity	IBA
GO:0004602	Function	Glutathione peroxidase activity	IDA	8428933, 36608588
GO:0004602	Function	Glutathione peroxidase activity	IEA
GO:0004602	Function	Glutathione peroxidase activity	TAS	8428933
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	8428933
GO:0005829	Component	Cytosol	IDA	8428933
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006979	Process	Response to oxidative stress	IEA
GO:0009055	Function	Electron transfer activity	TAS	8428933
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0045171	Component	Intercellular bridge	IDA
GO:0047066	Function	Phospholipid-hydroperoxide glutathione peroxidase activity	IDA	36608588
GO:0047066	Function	Phospholipid-hydroperoxide glutathione peroxidase activity	IEA
GO:0072686	Component	Mitotic spindle	IDA
GO:0098869	Process	Cellular oxidant detoxification	IEA

Other IDs

• MIM: 138319
• HGNC: 4554
• e!Ensembl: ENSG00000176153

Protein

• UniProt ID: P18283
• Protein name: Glutathione peroxidase 2 (GPx-2) (GSHPx-2) (EC 1.11.1.9) (Gastrointestinal glutathione peroxidase) (Glutathione peroxidase-gastrointestinal) (GPx-GI) (GSHPx-GI) (Glutathione peroxidase-related protein 2) (GPRP-2) (Phospholipid hydroperoxide glutathione pe
• Protein function: Catalyzes the reduction of hydroperoxides in a glutathione-dependent manner thus regulating cellular redox homeostasis (PubMed:36608588, PubMed:8428933). Can reduce small soluble hydroperoxides such as H2O2, cumene hydroperoxide and tert-butyl h
• PDB: 2HE3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00255	GSHPx	8 → 120	Glutathione peroxidase	Family

• Tissue specificity: TISSUE SPECIFICITY: Mostly in liver and gastrointestinal tract, not found in heart or kidney. {ECO:0000269|PubMed:8428933}.
• Sequence:

  MAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRR
  LVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLK
  DKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEP
  DIKRLLKVAI

• Sequence length: 190

Pathways

KEGG Pathway	Reactome Pathway
Glutathione metabolism	Synthesis of 12-eicosatetraenoic acid derivatives
Metabolic pathways	Synthesis of 15-eicosatetraenoic acid derivatives
Thyroid hormone synthesis	Detoxification of Reactive Oxygen Species
Amyotrophic lateral sclerosis	TP53 Regulates Metabolic Genes
Huntington disease
Pathways of neurodegeneration - multiple diseases

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (8)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
AUTISM SPECTRUM DISORDER	—	CTD	35663546	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	18056462	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	28108177	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	34290314	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	34290314	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	34290314	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	34290314	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (61)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28631563, 31695405		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	10965527		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	10965527, 15203372		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	17277236		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29662611		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10498757, 18056462, 24278290, 31814764		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	18056462		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21940907, 28631563	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	18056462, 28635398		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28635398	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29662611		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16915569, 23534707		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31695405		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	31695405		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	18467915, 18479189, 19289149, 26115075, 31765890		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15203372, 19047153, 23977205, 26682223		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	29393371		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	36796200, 37834097	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15203372, 23977205, 28631563, 31695405		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	28358699		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28631563, 30469315, 36796200, 37075346, 37743483	Associate	★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	26115075		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27388201	Associate	★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	17277236		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	37810778, 38132173	Associate	★☆☆☆☆ Found in Text Mining only
Ileitis	Ileitis	BEFREE	27930931		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	18467915, 31765890		★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	18479189, 19289149		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23867582, 28635398		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	CTD_human_DG	28108177		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	36222298	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28631563	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28635398	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10498757, 18056462, 24278290, 31814764		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	18056462		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	28108177		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16915569, 23534707		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31774184		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23143801, 24562575		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29662611		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19047153, 19289149, 23867582, 26682223, 28916653		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31695405		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15203372, 19047153, 23977205, 26682223		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	18056462		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	18056462		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	18056462		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28453466		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	28453466	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15734970, 19289149, 22391025, 22683372, 22758632, 23977205, 24562575, 28631563, 28635398		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31774184		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	39667505	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23143801, 24562575		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23143801, 36312753	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	36475041	Stimulate	★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	22371331		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	28916653		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28631563		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28631563, 37138031	Stimulate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29401402		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33622868	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	25813210, 29662611		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

GPX1 5 shared pathwaysGlutathione metabolism, Thyroid hormone synthesis, Detoxification of Reactive Oxygen Species, Synthesis of 12-eicosatetraenoic acid derivatives, Synthesis of 15-eicosatetraenoic acid derivatives Related via 5 shared pathways including Glutathione metabolism, Thyroid hormone synthesis. GPX3 1 shared diseaseLiver neoplasms 3 shared pathwaysGlutathione metabolism, Thyroid hormone synthesis, Detoxification of Reactive Oxygen Species 1 shared evidence sourceCTD (Liver neoplasms) Related via 3 shared pathways including Glutathione metabolism, Thyroid hormone synthesis — evidence mostly CTD. GPX6 3 shared pathwaysGlutathione metabolism, Thyroid hormone synthesis, Detoxification of Reactive Oxygen Species Related via 3 shared pathways including Glutathione metabolism, Thyroid hormone synthesis. GPX5 3 shared pathwaysGlutathione metabolism, Thyroid hormone synthesis, Detoxification of Reactive Oxygen Species Related via 3 shared pathways including Glutathione metabolism, Thyroid hormone synthesis. GPX7 3 shared pathwaysGlutathione metabolism, Thyroid hormone synthesis, Detoxification of Reactive Oxygen Species Related via 3 shared pathways including Glutathione metabolism, Thyroid hormone synthesis.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
GPX1	0	[]	5	["Glutathione metabolism","Thyroid hormone synthesis","Detoxification of Reactive Oxygen Species","Synthesis of 12-eicosatetraenoic acid derivatives","Synthesis of 15-eicosatetraenoic acid derivatives"]	0	[]
GPX3	1	["Liver neoplasms"]	3	["Glutathione metabolism","Thyroid hormone synthesis","Detoxification of Reactive Oxygen Species"]	1	["CTD (Liver neoplasms)"]
GPX6	0	[]	3	["Glutathione metabolism","Thyroid hormone synthesis","Detoxification of Reactive Oxygen Species"]	0	[]
GPX5	0	[]	3	["Glutathione metabolism","Thyroid hormone synthesis","Detoxification of Reactive Oxygen Species"]	0	[]
GPX7	0	[]	3	["Glutathione metabolism","Thyroid hormone synthesis","Detoxification of Reactive Oxygen Species"]	0	[]

Diseases Linked via Similar Genes

Coronary artery disease Linked via 2 of 5 related genesGPX1, GPX6 Major depressive disorder Linked via 2 of 5 related genesGPX1, GPX6 Diabetes mellitus type 2 Linked via 2 of 5 related genesGPX1, GPX3 Hypertension Linked via 2 of 5 related genesGPX1, GPX3 Lung neoplasms Linked via 2 of 5 related genesGPX1, GPX3

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Coronary artery disease	2	["GPX1","GPX6"]
Major depressive disorder	2	["GPX1","GPX6"]
Diabetes mellitus type 2	2	["GPX1","GPX3"]
Hypertension	2	["GPX1","GPX3"]
Lung neoplasms	2	["GPX1","GPX3"]