Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	53831
Gene name	G protein-coupled receptor 84
Gene symbol	GPR84
Synonyms (NCBI Gene)	EX33GPCR4
Chromosome	12
Chromosome location	12q13.13

10 Show/Hide all (10)

miRTarBase ID	miRNA	Experiments
MIRT1031919	hsa-miR-133a	CLIP-seq
MIRT1031920	hsa-miR-133b	CLIP-seq
MIRT1031921	hsa-miR-1910	CLIP-seq
MIRT1031922	hsa-miR-3140-5p	CLIP-seq
MIRT1031923	hsa-miR-3150b-3p	CLIP-seq
MIRT1031924	hsa-miR-3690	CLIP-seq
MIRT1031925	hsa-miR-4254	CLIP-seq
MIRT1031926	hsa-miR-4784	CLIP-seq
MIRT1031927	hsa-miR-765	CLIP-seq
MIRT2006083	hsa-miR-4445	CLIP-seq

13 Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001604	Function	Urotensin II receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0016020	Component	Membrane	IEA
GO:0035579	Component	Specific granule membrane	TAS
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0070821	Component	Tertiary granule membrane	TAS

MIM	HGNC	e!Ensembl
606383	4535	ENSG00000139572

Q9NQS5

Protein name

G-protein coupled receptor 84 (Inflammation-related G-protein coupled receptor EX33)

Protein function

G protein-coupled receptor that responds endogenously to dietary fatty acids or nutrient, specifically medium-chain free fatty acid (FFA) with carbon chain lengths of C9 to C14. Capric acid (C10:0), undecanoic acid (C11:0) and lauric acid (C12:0

PDB

8G05 , 8J18 , 8J19 , 8J1A

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	37 → 370	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed predominantly in hematopoietic tissues. High levels detected in the bone marrow and lower levels in the peripheral leukocytes and lung. Also expressed in brain, heart, muscle, colon, thymus, spleen, kidney, liver, placenta an

Sequence

MWNSSDANFSCYHESVLGYRYVAVSWGVVVAVTGTVGNVLTLLALAIQPKLRTRFNLLIA
NLTLADLLYCTLLQPFSVDTYLHLHWRTGATFCRVFGLLLFASNSVSILTLCLIALGRYL
LIAHPKLFPQVFSAKGIVLALVSTWVVGVASFAPLWPIYILVPVVCTCSFDRIRGRPYTT
ILMGIYFVLGLSSVGIFYCLIHRQVKRAAQALDQYKLRQASIHSNHVARTDEAMPGRFQE
LDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQP
IKGARRAPDSSSEFGKVTRMCFAVFLCFALSYIPFLLLNILDARVQAPRVVHMLAANLTW
LNGCINPVLYAAMNRQFRQAYGSILKRGPRSFHRLH

Sequence length

396

Interactions

View interactions

Reactome Pathway
G alpha (s) signalling events
Neutrophil degranulation
ADORA2B mediated anti-inflammatory cytokines production

GPR84 (G protein-coupled receptor 84)

Bookmark This Gene