Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	2838
Gene name	G protein-coupled receptor 15
Gene symbol	GPR15
Synonyms (NCBI Gene)	BOB
Chromosome	3
Chromosome location	3q11.2
Summary	This gene encodes a G protein-coupled receptor that acts as a chemokine receptor for human immunodeficiency virus type 1 and 2. The encoded protein localizes to the cell membrane. [provided by RefSeq, Nov 2012]

25 Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IMP	28386128
GO:0001618	Function	Virus receptor activity	IDA	15650194
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IDA	28900043, 28936214
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	28936214, 33758080
GO:0005737	Component	Cytoplasm	IDA	11696454
GO:0005768	Component	Endosome	IDA	28615320
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	28615320
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8838812
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	28900043, 28936214
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	34239069
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	ISS
GO:0015026	Function	Coreceptor activity	IDA	15650194
GO:0016020	Component	Membrane	IEA
GO:0046718	Process	Symbiont entry into host cell	IDA	15650194
GO:0072678	Process	T cell migration	IDA	20829352
GO:0072678	Process	T cell migration	IDA	38918398
GO:0072678	Process	T cell migration	IEA

MIM	HGNC	e!Ensembl
601166	4469	ENSG00000154165

P49685

Protein name

G-protein coupled receptor 15 (Brother of Bonzo) (BoB)

Protein function

G protein-coupled receptor that plays an important role in immune homeostasis (PubMed:33758080, PubMed:38918398). Acts via its natural ligand GPR15LG, a chemokine-like polypeptide strongly expressed in gastrointestinal tissues. GPR15-GPR15LG sig

PDB

8ZQE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	50 → 302	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in lymphoid tissues, including macrophages and peripheral blood mononuclear cells. {ECO:0000269|PubMed:9791028}.

Sequence

MDPEETSVYLDYYYATSPNSDIRETHSHVPYTSVFLPVFYTAVFLTGVLGNLVLMGALHF
KPGSRRLIDIFIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFLCKGSSYMISVNMHCS
VLLLTCMSVDRYLAIVWPVVSRKFRRTDCAYVVCASIWFISCLLGLPTLLSRELTLIDDK
PYCAEKKATPIKLIWSLVALIFTFFVPLLSIVTCYCCIARKLCAHYQQSGKHNKKLKKSI
KIIFIVVAAFLVSWLPFNTFKFLAIVSGLRQEHYLPSAILQLGMEVSGPLAFANSCVNPF
IYYIFDSYIRRAIVHCLCPCLKNYDFGSSTETSDSHLTKALSTFIHAEDFARRRKRSVSL

Sequence length

360

Interactions

View interactions

Reactome Pathway
G alpha (s) signalling events
ADORA2B mediated anti-inflammatory cytokines production

GPR15 (G protein-coupled receptor 15)

Save This Analysis