GLO1 (glyoxalase I)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 2739
• Gene name: Glyoxalase I
• Gene symbol: GLO1
• Synonyms (NCBI Gene): GLOD1, GLYI, HEL-S-74
• Chromosome: 6
• Chromosome location: 6p21.2
• Summary: The enzyme encoded by this gene is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. Glyoxalase I is linked to HLA and is localized to 6p21.3-p21.1, between HLA and the centromere

miRNA Show/Hide all (1018)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016416	hsa-miR-193b-3p	Microarray	20304954
MIRT025781	hsa-miR-7-5p	Microarray	19073608
MIRT032365	hsa-let-7b-5p	Proteomics	18668040
MIRT050980	hsa-miR-17-5p	CLASH	23622248
MIRT049258	hsa-miR-92a-3p	CLASH	23622248
MIRT047098	hsa-miR-183-5p	CLASH	23622248
MIRT046725	hsa-miR-222-3p	CLASH	23622248
MIRT640767	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT360812	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT360816	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT640766	hsa-miR-5193	HITS-CLIP	23824327
MIRT640765	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT360815	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT360813	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT640764	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT640763	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT640762	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT640761	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT562297	hsa-miR-6835-3p	PAR-CLIP	20371350
MIRT574757	hsa-miR-4422	PAR-CLIP	20371350
MIRT360805	hsa-miR-205-3p	PAR-CLIP	20371350
MIRT562295	hsa-miR-622	PAR-CLIP	20371350
MIRT239131	hsa-miR-1250-3p	PAR-CLIP	20371350
MIRT239128	hsa-miR-153-5p	PAR-CLIP	20371350
MIRT562293	hsa-miR-4796-5p	PAR-CLIP	20371350
MIRT562292	hsa-miR-9-3p	PAR-CLIP	20371350
MIRT562291	hsa-miR-137	PAR-CLIP	20371350
MIRT239133	hsa-miR-5696	PAR-CLIP	20371350
MIRT239130	hsa-miR-579-3p	PAR-CLIP	20371350
MIRT239132	hsa-miR-664b-3p	PAR-CLIP	20371350
MIRT562288	hsa-miR-30a-3p	PAR-CLIP	20371350
MIRT562287	hsa-miR-30d-3p	PAR-CLIP	20371350
MIRT562286	hsa-miR-30e-3p	PAR-CLIP	20371350
MIRT218910	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT168920	hsa-miR-3662	PAR-CLIP	20371350
MIRT523541	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT523540	hsa-miR-1272	PAR-CLIP	20371350
MIRT523539	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT523538	hsa-miR-569	PAR-CLIP	20371350
MIRT523537	hsa-miR-4775	PAR-CLIP	20371350
MIRT523536	hsa-miR-2053	PAR-CLIP	20371350
MIRT544138	hsa-miR-4432	PAR-CLIP	20371350
MIRT544137	hsa-miR-4712-3p	PAR-CLIP	20371350
MIRT562297	hsa-miR-6835-3p	PAR-CLIP	20371350
MIRT562296	hsa-miR-605-5p	PAR-CLIP	20371350
MIRT360805	hsa-miR-205-3p	PAR-CLIP	20371350
MIRT562295	hsa-miR-622	PAR-CLIP	20371350
MIRT239131	hsa-miR-1250-3p	PAR-CLIP	20371350
MIRT239128	hsa-miR-153-5p	PAR-CLIP	20371350
MIRT562293	hsa-miR-4796-5p	PAR-CLIP	20371350
MIRT562292	hsa-miR-9-3p	PAR-CLIP	20371350
MIRT562291	hsa-miR-137	PAR-CLIP	20371350
MIRT239133	hsa-miR-5696	PAR-CLIP	20371350
MIRT239130	hsa-miR-579-3p	PAR-CLIP	20371350
MIRT239132	hsa-miR-664b-3p	PAR-CLIP	20371350
MIRT562288	hsa-miR-30a-3p	PAR-CLIP	20371350
MIRT562287	hsa-miR-30d-3p	PAR-CLIP	20371350
MIRT562286	hsa-miR-30e-3p	PAR-CLIP	20371350
MIRT544138	hsa-miR-4432	PAR-CLIP	20371350
MIRT562299	hsa-miR-499a-3p	PAR-CLIP	20371350
MIRT562298	hsa-miR-499b-3p	PAR-CLIP	20371350
MIRT544137	hsa-miR-4712-3p	PAR-CLIP	20371350
MIRT544135	hsa-miR-539-5p	PAR-CLIP	20371350
MIRT562297	hsa-miR-6835-3p	PAR-CLIP	20371350
MIRT562296	hsa-miR-605-5p	PAR-CLIP	20371350
MIRT360805	hsa-miR-205-3p	PAR-CLIP	20371350
MIRT562295	hsa-miR-622	PAR-CLIP	20371350
MIRT239131	hsa-miR-1250-3p	PAR-CLIP	20371350
MIRT239128	hsa-miR-153-5p	PAR-CLIP	20371350
MIRT562294	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT562293	hsa-miR-4796-5p	PAR-CLIP	20371350
MIRT562292	hsa-miR-9-3p	PAR-CLIP	20371350
MIRT562291	hsa-miR-137	PAR-CLIP	20371350
MIRT239133	hsa-miR-5696	PAR-CLIP	20371350
MIRT239130	hsa-miR-579-3p	PAR-CLIP	20371350
MIRT239132	hsa-miR-664b-3p	PAR-CLIP	20371350
MIRT562290	hsa-miR-3616-5p	PAR-CLIP	20371350
MIRT562289	hsa-miR-573	PAR-CLIP	20371350
MIRT562288	hsa-miR-30a-3p	PAR-CLIP	20371350
MIRT562287	hsa-miR-30d-3p	PAR-CLIP	20371350
MIRT562286	hsa-miR-30e-3p	PAR-CLIP	20371350
MIRT562285	hsa-miR-1264	PAR-CLIP	20371350
MIRT544138	hsa-miR-4432	PAR-CLIP	21572407
MIRT544137	hsa-miR-4712-3p	PAR-CLIP	21572407
MIRT544135	hsa-miR-539-5p	PAR-CLIP	21572407
MIRT541302	hsa-miR-520d-3p	PAR-CLIP	21572407
MIRT541301	hsa-miR-302b-3p	PAR-CLIP	21572407
MIRT541300	hsa-miR-520a-3p	PAR-CLIP	21572407
MIRT541299	hsa-miR-373-3p	PAR-CLIP	21572407
MIRT541298	hsa-miR-372-3p	PAR-CLIP	21572407
MIRT541297	hsa-miR-302e	PAR-CLIP	21572407
MIRT541296	hsa-miR-302d-3p	PAR-CLIP	21572407
MIRT541295	hsa-miR-520b	PAR-CLIP	21572407
MIRT541294	hsa-miR-302a-3p	PAR-CLIP	21572407
MIRT541293	hsa-miR-520e	PAR-CLIP	21572407
MIRT541281	hsa-miR-302c-3p	PAR-CLIP	21572407
MIRT541292	hsa-miR-520c-3p	PAR-CLIP	21572407
MIRT541291	hsa-miR-3609	PAR-CLIP	21572407
MIRT541290	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT541289	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT440562	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT050980	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT440561	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT541288	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT541287	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT541286	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT541285	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT541284	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT541283	hsa-miR-4803	PAR-CLIP	21572407
MIRT317806	hsa-miR-651-3p	PAR-CLIP	21572407
MIRT541282	hsa-miR-4274	PAR-CLIP	21572407
MIRT360804	hsa-miR-4519	PAR-CLIP	21572407
MIRT317807	hsa-miR-4496	PAR-CLIP	21572407
MIRT541281	hsa-miR-302c-3p	PAR-CLIP	21572407
MIRT168911	hsa-miR-520f-3p	PAR-CLIP	21572407
MIRT360760	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT360767	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT541280	hsa-miR-494-3p	PAR-CLIP	21572407
MIRT541279	hsa-miR-103a-2-5p	PAR-CLIP	21572407
MIRT100646	hsa-miR-4261	PAR-CLIP	21572407
MIRT541278	hsa-miR-3622b-5p	PAR-CLIP	21572407
MIRT541277	hsa-miR-1287-3p	PAR-CLIP	21572407
MIRT541275	hsa-miR-4642	PAR-CLIP	21572407
MIRT445724	hsa-miR-4495	PAR-CLIP	23446348
MIRT445723	hsa-miR-379-3p	PAR-CLIP	23446348
MIRT445722	hsa-miR-411-3p	PAR-CLIP	23446348
MIRT445721	hsa-miR-380-3p	PAR-CLIP	23446348
MIRT445720	hsa-miR-4490	PAR-CLIP	23446348
MIRT445719	hsa-miR-4774-5p	PAR-CLIP	23446348
MIRT317803	hsa-miR-4635	PAR-CLIP	23446348
MIRT523542	hsa-miR-892c-3p	PAR-CLIP	23446348
MIRT218910	hsa-miR-548c-3p	PAR-CLIP	23446348
MIRT168920	hsa-miR-3662	PAR-CLIP	23446348
MIRT523541	hsa-miR-590-3p	PAR-CLIP	23446348
MIRT523540	hsa-miR-1272	PAR-CLIP	23446348
MIRT523539	hsa-miR-3682-3p	PAR-CLIP	23446348
MIRT523538	hsa-miR-569	PAR-CLIP	23446348
MIRT523537	hsa-miR-4775	PAR-CLIP	23446348
MIRT523536	hsa-miR-2053	PAR-CLIP	23446348
MIRT455697	hsa-miR-548an	PAR-CLIP	23592263
MIRT455696	hsa-miR-3714	PAR-CLIP	23592263
MIRT455695	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT455694	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT455693	hsa-miR-9500	PAR-CLIP	23592263
MIRT455692	hsa-miR-6815-5p	PAR-CLIP	23592263
MIRT455691	hsa-miR-6865-5p	PAR-CLIP	23592263
MIRT455689	hsa-miR-7515	PAR-CLIP	23592263
MIRT455690	hsa-miR-3179	PAR-CLIP	23592263
MIRT455688	hsa-miR-548ao-5p	PAR-CLIP	23592263
MIRT455687	hsa-miR-548ax	PAR-CLIP	23592263
MIRT455686	hsa-miR-298	PAR-CLIP	23592263
MIRT455684	hsa-miR-6800-5p	PAR-CLIP	23592263
MIRT455685	hsa-miR-6802-5p	PAR-CLIP	23592263
MIRT455683	hsa-miR-6126	PAR-CLIP	23592263
MIRT455682	hsa-miR-6864-5p	PAR-CLIP	23592263
MIRT455681	hsa-miR-6509-5p	PAR-CLIP	23592263
MIRT455680	hsa-miR-4678	PAR-CLIP	23592263
MIRT455679	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT032365	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT455678	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT455677	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT455676	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT455675	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT455674	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT455673	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT455672	hsa-miR-4458	PAR-CLIP	23592263
MIRT455671	hsa-miR-4500	PAR-CLIP	23592263
MIRT455670	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT455669	hsa-miR-202-3p	PAR-CLIP	23592263
MIRT455668	hsa-miR-3689d	PAR-CLIP	23592263
MIRT455667	hsa-miR-6851-5p	PAR-CLIP	23592263
MIRT455666	hsa-miR-5681b	PAR-CLIP	23592263
MIRT455665	hsa-miR-4316	PAR-CLIP	23592263
MIRT455664	hsa-miR-1294	PAR-CLIP	23592263
MIRT455663	hsa-miR-7847-3p	PAR-CLIP	23592263
MIRT445724	hsa-miR-4495	PAR-CLIP	22100165
MIRT445723	hsa-miR-379-3p	PAR-CLIP	22100165
MIRT445722	hsa-miR-411-3p	PAR-CLIP	22100165
MIRT445721	hsa-miR-380-3p	PAR-CLIP	22100165
MIRT445720	hsa-miR-4490	PAR-CLIP	22100165
MIRT445719	hsa-miR-4774-5p	PAR-CLIP	22100165
MIRT317803	hsa-miR-4635	PAR-CLIP	22100165
MIRT239127	hsa-miR-15b-3p	PAR-CLIP	22100165
MIRT445724	hsa-miR-4495	PAR-CLIP	22100165
MIRT445723	hsa-miR-379-3p	PAR-CLIP	22100165
MIRT445722	hsa-miR-411-3p	PAR-CLIP	22100165
MIRT445721	hsa-miR-380-3p	PAR-CLIP	22100165
MIRT445720	hsa-miR-4490	PAR-CLIP	22100165
MIRT445719	hsa-miR-4774-5p	PAR-CLIP	22100165
MIRT317803	hsa-miR-4635	PAR-CLIP	22100165
MIRT239127	hsa-miR-15b-3p	PAR-CLIP	22100165
MIRT440562	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT440561	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT440562	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT050980	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT541288	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT541285	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT541287	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT440561	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT455695	hsa-miR-1910-3p	PAR-CLIP	26701625
MIRT455695	hsa-miR-1910-3p	PAR-CLIP	26701625
MIRT455695	hsa-miR-1910-3p	PAR-CLIP	26701625
MIRT455695	hsa-miR-1910-3p	PAR-CLIP	26701625
MIRT455695	hsa-miR-1910-3p	PAR-CLIP	26701625
MIRT455695	hsa-miR-1910-3p	PAR-CLIP	26701625
MIRT455695	hsa-miR-1910-3p	PAR-CLIP	26701625
MIRT455695	hsa-miR-1910-3p	PAR-CLIP	26701625
MIRT455695	hsa-miR-1910-3p	PAR-CLIP	26701625
MIRT455695	hsa-miR-1910-3p	PAR-CLIP	26701625
MIRT455686	hsa-miR-298	PAR-CLIP	26701625
MIRT455686	hsa-miR-298	PAR-CLIP	26701625
MIRT455686	hsa-miR-298	PAR-CLIP	26701625
MIRT455686	hsa-miR-298	PAR-CLIP	26701625
MIRT455686	hsa-miR-298	PAR-CLIP	26701625
MIRT455686	hsa-miR-298	PAR-CLIP	26701625
MIRT455686	hsa-miR-298	PAR-CLIP	26701625
MIRT455686	hsa-miR-298	PAR-CLIP	26701625
MIRT455686	hsa-miR-298	PAR-CLIP	26701625
MIRT455686	hsa-miR-298	PAR-CLIP	26701625
MIRT455690	hsa-miR-3179	PAR-CLIP	26701625
MIRT455690	hsa-miR-3179	PAR-CLIP	26701625
MIRT455690	hsa-miR-3179	PAR-CLIP	26701625
MIRT455690	hsa-miR-3179	PAR-CLIP	26701625
MIRT455690	hsa-miR-3179	PAR-CLIP	26701625
MIRT455690	hsa-miR-3179	PAR-CLIP	26701625
MIRT455690	hsa-miR-3179	PAR-CLIP	26701625
MIRT455690	hsa-miR-3179	PAR-CLIP	26701625
MIRT455690	hsa-miR-3179	PAR-CLIP	26701625
MIRT455690	hsa-miR-3179	PAR-CLIP	26701625
MIRT455696	hsa-miR-3714	PAR-CLIP	26701625
MIRT455696	hsa-miR-3714	PAR-CLIP	26701625
MIRT455696	hsa-miR-3714	PAR-CLIP	26701625
MIRT455696	hsa-miR-3714	PAR-CLIP	26701625
MIRT455696	hsa-miR-3714	PAR-CLIP	26701625
MIRT455696	hsa-miR-3714	PAR-CLIP	26701625
MIRT455696	hsa-miR-3714	PAR-CLIP	26701625
MIRT455696	hsa-miR-3714	PAR-CLIP	26701625
MIRT455696	hsa-miR-3714	PAR-CLIP	26701625
MIRT455696	hsa-miR-3714	PAR-CLIP	26701625
MIRT455697	hsa-miR-548an	PAR-CLIP	26701625
MIRT455697	hsa-miR-548an	PAR-CLIP	26701625
MIRT455697	hsa-miR-548an	PAR-CLIP	26701625
MIRT455697	hsa-miR-548an	PAR-CLIP	26701625
MIRT455697	hsa-miR-548an	PAR-CLIP	26701625
MIRT455697	hsa-miR-548an	PAR-CLIP	26701625
MIRT455697	hsa-miR-548an	PAR-CLIP	26701625
MIRT455697	hsa-miR-548an	PAR-CLIP	26701625
MIRT455697	hsa-miR-548an	PAR-CLIP	26701625
MIRT455697	hsa-miR-548an	PAR-CLIP	26701625
MIRT455688	hsa-miR-548ao-5p	PAR-CLIP	26701625
MIRT455688	hsa-miR-548ao-5p	PAR-CLIP	26701625
MIRT455688	hsa-miR-548ao-5p	PAR-CLIP	26701625
MIRT455688	hsa-miR-548ao-5p	PAR-CLIP	26701625
MIRT455688	hsa-miR-548ao-5p	PAR-CLIP	26701625
MIRT455688	hsa-miR-548ao-5p	PAR-CLIP	26701625
MIRT455688	hsa-miR-548ao-5p	PAR-CLIP	26701625
MIRT455688	hsa-miR-548ao-5p	PAR-CLIP	26701625
MIRT455688	hsa-miR-548ao-5p	PAR-CLIP	26701625
MIRT455688	hsa-miR-548ao-5p	PAR-CLIP	26701625
MIRT455687	hsa-miR-548ax	PAR-CLIP	26701625
MIRT455687	hsa-miR-548ax	PAR-CLIP	26701625
MIRT455687	hsa-miR-548ax	PAR-CLIP	26701625
MIRT455687	hsa-miR-548ax	PAR-CLIP	26701625
MIRT455687	hsa-miR-548ax	PAR-CLIP	26701625
MIRT455687	hsa-miR-548ax	PAR-CLIP	26701625
MIRT455687	hsa-miR-548ax	PAR-CLIP	26701625
MIRT455687	hsa-miR-548ax	PAR-CLIP	26701625
MIRT455687	hsa-miR-548ax	PAR-CLIP	26701625
MIRT455687	hsa-miR-548ax	PAR-CLIP	26701625
MIRT455683	hsa-miR-6126	PAR-CLIP	26701625
MIRT455683	hsa-miR-6126	PAR-CLIP	26701625
MIRT455683	hsa-miR-6126	PAR-CLIP	26701625
MIRT455683	hsa-miR-6126	PAR-CLIP	26701625
MIRT455683	hsa-miR-6126	PAR-CLIP	26701625
MIRT455683	hsa-miR-6126	PAR-CLIP	26701625
MIRT455683	hsa-miR-6126	PAR-CLIP	26701625
MIRT455683	hsa-miR-6126	PAR-CLIP	26701625
MIRT455683	hsa-miR-6126	PAR-CLIP	26701625
MIRT455683	hsa-miR-6126	PAR-CLIP	26701625
MIRT455681	hsa-miR-6509-5p	PAR-CLIP	26701625
MIRT455681	hsa-miR-6509-5p	PAR-CLIP	26701625
MIRT455681	hsa-miR-6509-5p	PAR-CLIP	26701625
MIRT455681	hsa-miR-6509-5p	PAR-CLIP	26701625
MIRT455681	hsa-miR-6509-5p	PAR-CLIP	26701625
MIRT455681	hsa-miR-6509-5p	PAR-CLIP	26701625
MIRT455681	hsa-miR-6509-5p	PAR-CLIP	26701625
MIRT455681	hsa-miR-6509-5p	PAR-CLIP	26701625
MIRT455681	hsa-miR-6509-5p	PAR-CLIP	26701625
MIRT455681	hsa-miR-6509-5p	PAR-CLIP	26701625
MIRT455694	hsa-miR-6511a-5p	PAR-CLIP	26701625
MIRT455694	hsa-miR-6511a-5p	PAR-CLIP	26701625
MIRT455694	hsa-miR-6511a-5p	PAR-CLIP	26701625
MIRT455694	hsa-miR-6511a-5p	PAR-CLIP	26701625
MIRT455694	hsa-miR-6511a-5p	PAR-CLIP	26701625
MIRT455694	hsa-miR-6511a-5p	PAR-CLIP	26701625
MIRT455694	hsa-miR-6511a-5p	PAR-CLIP	26701625
MIRT455694	hsa-miR-6511a-5p	PAR-CLIP	26701625
MIRT455694	hsa-miR-6511a-5p	PAR-CLIP	26701625
MIRT455694	hsa-miR-6511a-5p	PAR-CLIP	26701625
MIRT455684	hsa-miR-6800-5p	PAR-CLIP	26701625
MIRT455684	hsa-miR-6800-5p	PAR-CLIP	26701625
MIRT455684	hsa-miR-6800-5p	PAR-CLIP	26701625
MIRT455684	hsa-miR-6800-5p	PAR-CLIP	26701625
MIRT455684	hsa-miR-6800-5p	PAR-CLIP	26701625
MIRT455684	hsa-miR-6800-5p	PAR-CLIP	26701625
MIRT455684	hsa-miR-6800-5p	PAR-CLIP	26701625
MIRT455684	hsa-miR-6800-5p	PAR-CLIP	26701625
MIRT455684	hsa-miR-6800-5p	PAR-CLIP	26701625
MIRT455684	hsa-miR-6800-5p	PAR-CLIP	26701625
MIRT455685	hsa-miR-6802-5p	PAR-CLIP	26701625
MIRT455685	hsa-miR-6802-5p	PAR-CLIP	26701625
MIRT455685	hsa-miR-6802-5p	PAR-CLIP	26701625
MIRT455685	hsa-miR-6802-5p	PAR-CLIP	26701625
MIRT455685	hsa-miR-6802-5p	PAR-CLIP	26701625
MIRT455685	hsa-miR-6802-5p	PAR-CLIP	26701625
MIRT455685	hsa-miR-6802-5p	PAR-CLIP	26701625
MIRT455685	hsa-miR-6802-5p	PAR-CLIP	26701625
MIRT455685	hsa-miR-6802-5p	PAR-CLIP	26701625
MIRT455685	hsa-miR-6802-5p	PAR-CLIP	26701625
MIRT455692	hsa-miR-6815-5p	PAR-CLIP	26701625
MIRT455692	hsa-miR-6815-5p	PAR-CLIP	26701625
MIRT455692	hsa-miR-6815-5p	PAR-CLIP	26701625
MIRT455692	hsa-miR-6815-5p	PAR-CLIP	26701625
MIRT455692	hsa-miR-6815-5p	PAR-CLIP	26701625
MIRT455692	hsa-miR-6815-5p	PAR-CLIP	26701625
MIRT455692	hsa-miR-6815-5p	PAR-CLIP	26701625
MIRT455692	hsa-miR-6815-5p	PAR-CLIP	26701625
MIRT455692	hsa-miR-6815-5p	PAR-CLIP	26701625
MIRT455692	hsa-miR-6815-5p	PAR-CLIP	26701625
MIRT455682	hsa-miR-6864-5p	PAR-CLIP	26701625
MIRT455682	hsa-miR-6864-5p	PAR-CLIP	26701625
MIRT455682	hsa-miR-6864-5p	PAR-CLIP	26701625
MIRT455682	hsa-miR-6864-5p	PAR-CLIP	26701625
MIRT455682	hsa-miR-6864-5p	PAR-CLIP	26701625
MIRT455682	hsa-miR-6864-5p	PAR-CLIP	26701625
MIRT455682	hsa-miR-6864-5p	PAR-CLIP	26701625
MIRT455682	hsa-miR-6864-5p	PAR-CLIP	26701625
MIRT455682	hsa-miR-6864-5p	PAR-CLIP	26701625
MIRT455682	hsa-miR-6864-5p	PAR-CLIP	26701625
MIRT455691	hsa-miR-6865-5p	PAR-CLIP	26701625
MIRT455691	hsa-miR-6865-5p	PAR-CLIP	26701625
MIRT455691	hsa-miR-6865-5p	PAR-CLIP	26701625
MIRT455691	hsa-miR-6865-5p	PAR-CLIP	26701625
MIRT455691	hsa-miR-6865-5p	PAR-CLIP	26701625
MIRT455691	hsa-miR-6865-5p	PAR-CLIP	26701625
MIRT455691	hsa-miR-6865-5p	PAR-CLIP	26701625
MIRT455691	hsa-miR-6865-5p	PAR-CLIP	26701625
MIRT455691	hsa-miR-6865-5p	PAR-CLIP	26701625
MIRT455691	hsa-miR-6865-5p	PAR-CLIP	26701625
MIRT455689	hsa-miR-7515	PAR-CLIP	26701625
MIRT455689	hsa-miR-7515	PAR-CLIP	26701625
MIRT455689	hsa-miR-7515	PAR-CLIP	26701625
MIRT455689	hsa-miR-7515	PAR-CLIP	26701625
MIRT455689	hsa-miR-7515	PAR-CLIP	26701625
MIRT455689	hsa-miR-7515	PAR-CLIP	26701625
MIRT455689	hsa-miR-7515	PAR-CLIP	26701625
MIRT455689	hsa-miR-7515	PAR-CLIP	26701625
MIRT455689	hsa-miR-7515	PAR-CLIP	26701625
MIRT455689	hsa-miR-7515	PAR-CLIP	26701625
MIRT455693	hsa-miR-9500	PAR-CLIP	26701625
MIRT455693	hsa-miR-9500	PAR-CLIP	26701625
MIRT455693	hsa-miR-9500	PAR-CLIP	26701625
MIRT455693	hsa-miR-9500	PAR-CLIP	26701625
MIRT455693	hsa-miR-9500	PAR-CLIP	26701625
MIRT455693	hsa-miR-9500	PAR-CLIP	26701625
MIRT455693	hsa-miR-9500	PAR-CLIP	26701625
MIRT455693	hsa-miR-9500	PAR-CLIP	26701625
MIRT455693	hsa-miR-9500	PAR-CLIP	26701625
MIRT455693	hsa-miR-9500	PAR-CLIP	26701625
MIRT640767	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT360812	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT360816	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT640766	hsa-miR-5193	HITS-CLIP	23824327
MIRT640765	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT360815	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT360813	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT640764	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT640763	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT640762	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT640761	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT562297	hsa-miR-6835-3p	PAR-CLIP	20371350
MIRT574757	hsa-miR-4422	PAR-CLIP	20371350
MIRT360805	hsa-miR-205-3p	PAR-CLIP	20371350
MIRT562295	hsa-miR-622	PAR-CLIP	20371350
MIRT239131	hsa-miR-1250-3p	PAR-CLIP	20371350
MIRT239128	hsa-miR-153-5p	PAR-CLIP	20371350
MIRT562293	hsa-miR-4796-5p	PAR-CLIP	20371350
MIRT562292	hsa-miR-9-3p	PAR-CLIP	20371350
MIRT562291	hsa-miR-137	PAR-CLIP	20371350
MIRT239133	hsa-miR-5696	PAR-CLIP	20371350
MIRT239130	hsa-miR-579-3p	PAR-CLIP	20371350
MIRT239132	hsa-miR-664b-3p	PAR-CLIP	20371350
MIRT562288	hsa-miR-30a-3p	PAR-CLIP	20371350
MIRT562287	hsa-miR-30d-3p	PAR-CLIP	20371350
MIRT562286	hsa-miR-30e-3p	PAR-CLIP	20371350
MIRT218910	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT168920	hsa-miR-3662	PAR-CLIP	20371350
MIRT523541	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT523540	hsa-miR-1272	PAR-CLIP	20371350
MIRT523539	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT523538	hsa-miR-569	PAR-CLIP	20371350
MIRT523537	hsa-miR-4775	PAR-CLIP	20371350
MIRT523536	hsa-miR-2053	PAR-CLIP	20371350
MIRT544138	hsa-miR-4432	PAR-CLIP	20371350
MIRT544137	hsa-miR-4712-3p	PAR-CLIP	20371350
MIRT562297	hsa-miR-6835-3p	PAR-CLIP	20371350
MIRT562296	hsa-miR-605-5p	PAR-CLIP	20371350
MIRT360805	hsa-miR-205-3p	PAR-CLIP	20371350
MIRT562295	hsa-miR-622	PAR-CLIP	20371350
MIRT239131	hsa-miR-1250-3p	PAR-CLIP	20371350
MIRT239128	hsa-miR-153-5p	PAR-CLIP	20371350
MIRT562293	hsa-miR-4796-5p	PAR-CLIP	20371350
MIRT562292	hsa-miR-9-3p	PAR-CLIP	20371350
MIRT562291	hsa-miR-137	PAR-CLIP	20371350
MIRT239133	hsa-miR-5696	PAR-CLIP	20371350
MIRT239130	hsa-miR-579-3p	PAR-CLIP	20371350
MIRT239132	hsa-miR-664b-3p	PAR-CLIP	20371350
MIRT562288	hsa-miR-30a-3p	PAR-CLIP	20371350
MIRT562287	hsa-miR-30d-3p	PAR-CLIP	20371350
MIRT562286	hsa-miR-30e-3p	PAR-CLIP	20371350
MIRT544138	hsa-miR-4432	PAR-CLIP	20371350
MIRT562299	hsa-miR-499a-3p	PAR-CLIP	20371350
MIRT562298	hsa-miR-499b-3p	PAR-CLIP	20371350
MIRT544137	hsa-miR-4712-3p	PAR-CLIP	20371350
MIRT544135	hsa-miR-539-5p	PAR-CLIP	20371350
MIRT562297	hsa-miR-6835-3p	PAR-CLIP	20371350
MIRT562296	hsa-miR-605-5p	PAR-CLIP	20371350
MIRT360805	hsa-miR-205-3p	PAR-CLIP	20371350
MIRT562295	hsa-miR-622	PAR-CLIP	20371350
MIRT239131	hsa-miR-1250-3p	PAR-CLIP	20371350
MIRT239128	hsa-miR-153-5p	PAR-CLIP	20371350
MIRT562294	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT562293	hsa-miR-4796-5p	PAR-CLIP	20371350
MIRT562292	hsa-miR-9-3p	PAR-CLIP	20371350
MIRT562291	hsa-miR-137	PAR-CLIP	20371350
MIRT239133	hsa-miR-5696	PAR-CLIP	20371350
MIRT239130	hsa-miR-579-3p	PAR-CLIP	20371350
MIRT239132	hsa-miR-664b-3p	PAR-CLIP	20371350
MIRT562290	hsa-miR-3616-5p	PAR-CLIP	20371350
MIRT562289	hsa-miR-573	PAR-CLIP	20371350
MIRT562288	hsa-miR-30a-3p	PAR-CLIP	20371350
MIRT562287	hsa-miR-30d-3p	PAR-CLIP	20371350
MIRT562286	hsa-miR-30e-3p	PAR-CLIP	20371350
MIRT562285	hsa-miR-1264	PAR-CLIP	20371350
MIRT544138	hsa-miR-4432	PAR-CLIP	21572407
MIRT544137	hsa-miR-4712-3p	PAR-CLIP	21572407
MIRT544135	hsa-miR-539-5p	PAR-CLIP	21572407
MIRT541302	hsa-miR-520d-3p	PAR-CLIP	21572407
MIRT541301	hsa-miR-302b-3p	PAR-CLIP	21572407
MIRT541300	hsa-miR-520a-3p	PAR-CLIP	21572407
MIRT541299	hsa-miR-373-3p	PAR-CLIP	21572407
MIRT541298	hsa-miR-372-3p	PAR-CLIP	21572407
MIRT541297	hsa-miR-302e	PAR-CLIP	21572407
MIRT541296	hsa-miR-302d-3p	PAR-CLIP	21572407
MIRT541295	hsa-miR-520b	PAR-CLIP	21572407
MIRT541294	hsa-miR-302a-3p	PAR-CLIP	21572407
MIRT541293	hsa-miR-520e	PAR-CLIP	21572407
MIRT541281	hsa-miR-302c-3p	PAR-CLIP	21572407
MIRT541292	hsa-miR-520c-3p	PAR-CLIP	21572407
MIRT541291	hsa-miR-3609	PAR-CLIP	21572407
MIRT541290	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT541289	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT440562	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT050980	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT440561	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT541288	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT541287	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT541286	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT541285	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT541284	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT541283	hsa-miR-4803	PAR-CLIP	21572407
MIRT317806	hsa-miR-651-3p	PAR-CLIP	21572407
MIRT541282	hsa-miR-4274	PAR-CLIP	21572407
MIRT360804	hsa-miR-4519	PAR-CLIP	21572407
MIRT317807	hsa-miR-4496	PAR-CLIP	21572407
MIRT541281	hsa-miR-302c-3p	PAR-CLIP	21572407
MIRT168911	hsa-miR-520f-3p	PAR-CLIP	21572407
MIRT360760	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT360767	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT541280	hsa-miR-494-3p	PAR-CLIP	21572407
MIRT541279	hsa-miR-103a-2-5p	PAR-CLIP	21572407
MIRT100646	hsa-miR-4261	PAR-CLIP	21572407
MIRT541278	hsa-miR-3622b-5p	PAR-CLIP	21572407
MIRT541277	hsa-miR-1287-3p	PAR-CLIP	21572407
MIRT541275	hsa-miR-4642	PAR-CLIP	21572407
MIRT445724	hsa-miR-4495	PAR-CLIP	23446348
MIRT445723	hsa-miR-379-3p	PAR-CLIP	23446348
MIRT445722	hsa-miR-411-3p	PAR-CLIP	23446348
MIRT445721	hsa-miR-380-3p	PAR-CLIP	23446348
MIRT445720	hsa-miR-4490	PAR-CLIP	23446348
MIRT445719	hsa-miR-4774-5p	PAR-CLIP	23446348
MIRT317803	hsa-miR-4635	PAR-CLIP	23446348
MIRT523542	hsa-miR-892c-3p	PAR-CLIP	23446348
MIRT218910	hsa-miR-548c-3p	PAR-CLIP	23446348
MIRT168920	hsa-miR-3662	PAR-CLIP	23446348
MIRT523541	hsa-miR-590-3p	PAR-CLIP	23446348
MIRT523540	hsa-miR-1272	PAR-CLIP	23446348
MIRT523539	hsa-miR-3682-3p	PAR-CLIP	23446348
MIRT523538	hsa-miR-569	PAR-CLIP	23446348
MIRT523537	hsa-miR-4775	PAR-CLIP	23446348
MIRT523536	hsa-miR-2053	PAR-CLIP	23446348
MIRT455697	hsa-miR-548an	PAR-CLIP	23592263
MIRT455696	hsa-miR-3714	PAR-CLIP	23592263
MIRT455695	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT455694	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT455693	hsa-miR-9500	PAR-CLIP	23592263
MIRT455692	hsa-miR-6815-5p	PAR-CLIP	23592263
MIRT455691	hsa-miR-6865-5p	PAR-CLIP	23592263
MIRT455689	hsa-miR-7515	PAR-CLIP	23592263
MIRT455690	hsa-miR-3179	PAR-CLIP	23592263
MIRT455688	hsa-miR-548ao-5p	PAR-CLIP	23592263
MIRT455687	hsa-miR-548ax	PAR-CLIP	23592263
MIRT455686	hsa-miR-298	PAR-CLIP	23592263
MIRT455684	hsa-miR-6800-5p	PAR-CLIP	23592263
MIRT455685	hsa-miR-6802-5p	PAR-CLIP	23592263
MIRT455683	hsa-miR-6126	PAR-CLIP	23592263
MIRT455682	hsa-miR-6864-5p	PAR-CLIP	23592263
MIRT455681	hsa-miR-6509-5p	PAR-CLIP	23592263
MIRT455680	hsa-miR-4678	PAR-CLIP	23592263
MIRT455679	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT032365	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT455678	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT455677	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT455676	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT455675	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT455674	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT455673	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT455672	hsa-miR-4458	PAR-CLIP	23592263
MIRT455671	hsa-miR-4500	PAR-CLIP	23592263
MIRT455670	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT455669	hsa-miR-202-3p	PAR-CLIP	23592263
MIRT455668	hsa-miR-3689d	PAR-CLIP	23592263
MIRT455667	hsa-miR-6851-5p	PAR-CLIP	23592263
MIRT455666	hsa-miR-5681b	PAR-CLIP	23592263
MIRT455665	hsa-miR-4316	PAR-CLIP	23592263
MIRT455664	hsa-miR-1294	PAR-CLIP	23592263
MIRT455663	hsa-miR-7847-3p	PAR-CLIP	23592263
MIRT445724	hsa-miR-4495	PAR-CLIP	22100165
MIRT445723	hsa-miR-379-3p	PAR-CLIP	22100165
MIRT445722	hsa-miR-411-3p	PAR-CLIP	22100165
MIRT445721	hsa-miR-380-3p	PAR-CLIP	22100165
MIRT445720	hsa-miR-4490	PAR-CLIP	22100165
MIRT445719	hsa-miR-4774-5p	PAR-CLIP	22100165
MIRT317803	hsa-miR-4635	PAR-CLIP	22100165
MIRT239127	hsa-miR-15b-3p	PAR-CLIP	22100165
MIRT445724	hsa-miR-4495	PAR-CLIP	22100165
MIRT445723	hsa-miR-379-3p	PAR-CLIP	22100165
MIRT445722	hsa-miR-411-3p	PAR-CLIP	22100165
MIRT445721	hsa-miR-380-3p	PAR-CLIP	22100165
MIRT445720	hsa-miR-4490	PAR-CLIP	22100165
MIRT445719	hsa-miR-4774-5p	PAR-CLIP	22100165
MIRT317803	hsa-miR-4635	PAR-CLIP	22100165
MIRT239127	hsa-miR-15b-3p	PAR-CLIP	22100165
MIRT1021271	hsa-let-7a	CLIP-seq
MIRT1021272	hsa-let-7b	CLIP-seq
MIRT1021273	hsa-let-7c	CLIP-seq
MIRT1021274	hsa-let-7d	CLIP-seq
MIRT1021275	hsa-let-7e	CLIP-seq
MIRT1021276	hsa-let-7f	CLIP-seq
MIRT1021277	hsa-let-7g	CLIP-seq
MIRT1021278	hsa-let-7i	CLIP-seq
MIRT1021279	hsa-miR-106a	CLIP-seq
MIRT1021280	hsa-miR-106b	CLIP-seq
MIRT1021281	hsa-miR-1243	CLIP-seq
MIRT1021282	hsa-miR-1245	CLIP-seq
MIRT1021283	hsa-miR-1269	CLIP-seq
MIRT1021284	hsa-miR-1269b	CLIP-seq
MIRT1021285	hsa-miR-1273e	CLIP-seq
MIRT1021286	hsa-miR-1288	CLIP-seq
MIRT1021287	hsa-miR-1303	CLIP-seq
MIRT1021288	hsa-miR-17	CLIP-seq
MIRT1021289	hsa-miR-1908	CLIP-seq
MIRT1021290	hsa-miR-1910	CLIP-seq
MIRT1021291	hsa-miR-202	CLIP-seq
MIRT1021292	hsa-miR-20a	CLIP-seq
MIRT1021293	hsa-miR-20b	CLIP-seq
MIRT1021294	hsa-miR-23a	CLIP-seq
MIRT1021295	hsa-miR-23b	CLIP-seq
MIRT1021296	hsa-miR-23c	CLIP-seq
MIRT1021297	hsa-miR-2681	CLIP-seq
MIRT1021298	hsa-miR-302a	CLIP-seq
MIRT1021299	hsa-miR-302b	CLIP-seq
MIRT1021300	hsa-miR-302c	CLIP-seq
MIRT1021301	hsa-miR-302d	CLIP-seq
MIRT1021302	hsa-miR-3129-3p	CLIP-seq
MIRT1021303	hsa-miR-3136-5p	CLIP-seq
MIRT1021304	hsa-miR-3160-3p	CLIP-seq
MIRT1021305	hsa-miR-3202	CLIP-seq
MIRT1021306	hsa-miR-34c-3p	CLIP-seq
MIRT1021307	hsa-miR-3614-5p	CLIP-seq
MIRT1021308	hsa-miR-372	CLIP-seq
MIRT1021309	hsa-miR-373	CLIP-seq
MIRT1021310	hsa-miR-380	CLIP-seq
MIRT1021311	hsa-miR-4271	CLIP-seq
MIRT1021312	hsa-miR-4303	CLIP-seq
MIRT1021313	hsa-miR-4307	CLIP-seq
MIRT1021314	hsa-miR-4420	CLIP-seq
MIRT1021315	hsa-miR-4439	CLIP-seq
MIRT1021316	hsa-miR-4476	CLIP-seq
MIRT1021317	hsa-miR-4487	CLIP-seq
MIRT1021318	hsa-miR-4513	CLIP-seq
MIRT1021319	hsa-miR-4515	CLIP-seq
MIRT1021320	hsa-miR-455-3p	CLIP-seq
MIRT1021321	hsa-miR-4694-3p	CLIP-seq
MIRT1021322	hsa-miR-4706	CLIP-seq
MIRT1021323	hsa-miR-4724-5p	CLIP-seq
MIRT1021324	hsa-miR-4725-3p	CLIP-seq
MIRT1021325	hsa-miR-4740-5p	CLIP-seq
MIRT1021326	hsa-miR-4749-5p	CLIP-seq
MIRT1021327	hsa-miR-4762-3p	CLIP-seq
MIRT1021328	hsa-miR-4764-5p	CLIP-seq
MIRT1021329	hsa-miR-494	CLIP-seq
MIRT1021330	hsa-miR-499-3p	CLIP-seq
MIRT1021331	hsa-miR-5096	CLIP-seq
MIRT1021332	hsa-miR-519d	CLIP-seq
MIRT1021333	hsa-miR-520f	CLIP-seq
MIRT1021334	hsa-miR-539	CLIP-seq
MIRT1021335	hsa-miR-548ah	CLIP-seq
MIRT1021336	hsa-miR-558	CLIP-seq
MIRT1021337	hsa-miR-570	CLIP-seq
MIRT1021338	hsa-miR-577	CLIP-seq
MIRT1021339	hsa-miR-579	CLIP-seq
MIRT1021340	hsa-miR-581	CLIP-seq
MIRT1021341	hsa-miR-605	CLIP-seq
MIRT1021342	hsa-miR-640	CLIP-seq
MIRT1021343	hsa-miR-663	CLIP-seq
MIRT1021344	hsa-miR-7	CLIP-seq
MIRT1021345	hsa-miR-93	CLIP-seq
MIRT1021346	hsa-miR-98	CLIP-seq
MIRT1021271	hsa-let-7a	CLIP-seq
MIRT1021272	hsa-let-7b	CLIP-seq
MIRT1021273	hsa-let-7c	CLIP-seq
MIRT1021274	hsa-let-7d	CLIP-seq
MIRT1021275	hsa-let-7e	CLIP-seq
MIRT1021276	hsa-let-7f	CLIP-seq
MIRT1021277	hsa-let-7g	CLIP-seq
MIRT1021278	hsa-let-7i	CLIP-seq
MIRT1021279	hsa-miR-106a	CLIP-seq
MIRT1021280	hsa-miR-106b	CLIP-seq
MIRT2002580	hsa-miR-1226	CLIP-seq
MIRT1021282	hsa-miR-1245	CLIP-seq
MIRT1021283	hsa-miR-1269	CLIP-seq
MIRT1021284	hsa-miR-1269b	CLIP-seq
MIRT1021286	hsa-miR-1288	CLIP-seq
MIRT1021288	hsa-miR-17	CLIP-seq
MIRT1021290	hsa-miR-1910	CLIP-seq
MIRT2002581	hsa-miR-1911	CLIP-seq
MIRT1021291	hsa-miR-202	CLIP-seq
MIRT1021292	hsa-miR-20a	CLIP-seq
MIRT1021293	hsa-miR-20b	CLIP-seq
MIRT2002582	hsa-miR-219-2-3p	CLIP-seq
MIRT2002583	hsa-miR-2278	CLIP-seq
MIRT1021294	hsa-miR-23a	CLIP-seq
MIRT1021295	hsa-miR-23b	CLIP-seq
MIRT1021296	hsa-miR-23c	CLIP-seq
MIRT2002584	hsa-miR-2964a-3p	CLIP-seq
MIRT1021298	hsa-miR-302a	CLIP-seq
MIRT1021299	hsa-miR-302b	CLIP-seq
MIRT1021300	hsa-miR-302c	CLIP-seq
MIRT1021301	hsa-miR-302d	CLIP-seq
MIRT2002585	hsa-miR-302f	CLIP-seq
MIRT2002586	hsa-miR-3189-3p	CLIP-seq
MIRT1021305	hsa-miR-3202	CLIP-seq
MIRT2002587	hsa-miR-335	CLIP-seq
MIRT2002588	hsa-miR-34b	CLIP-seq
MIRT2002589	hsa-miR-3545-3p	CLIP-seq
MIRT1021307	hsa-miR-3614-5p	CLIP-seq
MIRT2002590	hsa-miR-362-5p	CLIP-seq
MIRT2002591	hsa-miR-3646	CLIP-seq
MIRT2002592	hsa-miR-3647-5p	CLIP-seq
MIRT2002593	hsa-miR-3657	CLIP-seq
MIRT2002594	hsa-miR-369-3p	CLIP-seq
MIRT1021308	hsa-miR-372	CLIP-seq
MIRT1021309	hsa-miR-373	CLIP-seq
MIRT2002595	hsa-miR-374a	CLIP-seq
MIRT2002596	hsa-miR-374b	CLIP-seq
MIRT1021310	hsa-miR-380	CLIP-seq
MIRT2002597	hsa-miR-3934	CLIP-seq
MIRT2002598	hsa-miR-4255	CLIP-seq
MIRT2002599	hsa-miR-4310	CLIP-seq
MIRT2002600	hsa-miR-4328	CLIP-seq
MIRT2002601	hsa-miR-4452	CLIP-seq
MIRT1021316	hsa-miR-4476	CLIP-seq
MIRT2002602	hsa-miR-450b-3p	CLIP-seq
MIRT1021319	hsa-miR-4515	CLIP-seq
MIRT2002603	hsa-miR-4540	CLIP-seq
MIRT1021320	hsa-miR-455-3p	CLIP-seq
MIRT1021321	hsa-miR-4694-3p	CLIP-seq
MIRT2002604	hsa-miR-4733-3p	CLIP-seq
MIRT1021325	hsa-miR-4740-5p	CLIP-seq
MIRT2002605	hsa-miR-4744	CLIP-seq
MIRT1021329	hsa-miR-494	CLIP-seq
MIRT1021330	hsa-miR-499-3p	CLIP-seq
MIRT2002606	hsa-miR-500b	CLIP-seq
MIRT2002607	hsa-miR-501-5p	CLIP-seq
MIRT1021331	hsa-miR-5096	CLIP-seq
MIRT1021332	hsa-miR-519d	CLIP-seq
MIRT1021333	hsa-miR-520f	CLIP-seq
MIRT1021334	hsa-miR-539	CLIP-seq
MIRT1021335	hsa-miR-548ah	CLIP-seq
MIRT2002608	hsa-miR-548u	CLIP-seq
MIRT1021339	hsa-miR-579	CLIP-seq
MIRT1021340	hsa-miR-581	CLIP-seq
MIRT1021341	hsa-miR-605	CLIP-seq
MIRT1021342	hsa-miR-640	CLIP-seq
MIRT1021344	hsa-miR-7	CLIP-seq
MIRT2002609	hsa-miR-769-3p	CLIP-seq
MIRT1021345	hsa-miR-93	CLIP-seq
MIRT1021346	hsa-miR-98	CLIP-seq
MIRT1021271	hsa-let-7a	CLIP-seq
MIRT1021272	hsa-let-7b	CLIP-seq
MIRT1021273	hsa-let-7c	CLIP-seq
MIRT1021274	hsa-let-7d	CLIP-seq
MIRT1021275	hsa-let-7e	CLIP-seq
MIRT1021276	hsa-let-7f	CLIP-seq
MIRT1021277	hsa-let-7g	CLIP-seq
MIRT1021278	hsa-let-7i	CLIP-seq
MIRT2235569	hsa-miR-105	CLIP-seq
MIRT1021279	hsa-miR-106a	CLIP-seq
MIRT1021280	hsa-miR-106b	CLIP-seq
MIRT2235570	hsa-miR-1225-5p	CLIP-seq
MIRT2235571	hsa-miR-1231	CLIP-seq
MIRT1021282	hsa-miR-1245	CLIP-seq
MIRT1021283	hsa-miR-1269	CLIP-seq
MIRT1021284	hsa-miR-1269b	CLIP-seq
MIRT1021286	hsa-miR-1288	CLIP-seq
MIRT1021287	hsa-miR-1303	CLIP-seq
MIRT2235572	hsa-miR-1304	CLIP-seq
MIRT2235573	hsa-miR-135a	CLIP-seq
MIRT2235574	hsa-miR-135b	CLIP-seq
MIRT1021288	hsa-miR-17	CLIP-seq
MIRT2235575	hsa-miR-1827	CLIP-seq
MIRT1021290	hsa-miR-1910	CLIP-seq
MIRT2235576	hsa-miR-193a-3p	CLIP-seq
MIRT2235577	hsa-miR-193b	CLIP-seq
MIRT1021291	hsa-miR-202	CLIP-seq
MIRT1021292	hsa-miR-20a	CLIP-seq
MIRT1021293	hsa-miR-20b	CLIP-seq
MIRT2002583	hsa-miR-2278	CLIP-seq
MIRT1021294	hsa-miR-23a	CLIP-seq
MIRT1021295	hsa-miR-23b	CLIP-seq
MIRT1021296	hsa-miR-23c	CLIP-seq
MIRT1021298	hsa-miR-302a	CLIP-seq
MIRT1021299	hsa-miR-302b	CLIP-seq
MIRT1021300	hsa-miR-302c	CLIP-seq
MIRT1021301	hsa-miR-302d	CLIP-seq
MIRT1021302	hsa-miR-3129-3p	CLIP-seq
MIRT2235578	hsa-miR-3135	CLIP-seq
MIRT1021304	hsa-miR-3160-3p	CLIP-seq
MIRT2235579	hsa-miR-3160-5p	CLIP-seq
MIRT2002586	hsa-miR-3189-3p	CLIP-seq
MIRT1021305	hsa-miR-3202	CLIP-seq
MIRT2002587	hsa-miR-335	CLIP-seq
MIRT2002588	hsa-miR-34b	CLIP-seq
MIRT1021306	hsa-miR-34c-3p	CLIP-seq
MIRT2235580	hsa-miR-3653	CLIP-seq
MIRT2002594	hsa-miR-369-3p	CLIP-seq
MIRT1021308	hsa-miR-372	CLIP-seq
MIRT1021309	hsa-miR-373	CLIP-seq
MIRT2002595	hsa-miR-374a	CLIP-seq
MIRT2002596	hsa-miR-374b	CLIP-seq
MIRT1021310	hsa-miR-380	CLIP-seq
MIRT2002598	hsa-miR-4255	CLIP-seq
MIRT2235581	hsa-miR-4293	CLIP-seq
MIRT1021312	hsa-miR-4303	CLIP-seq
MIRT1021313	hsa-miR-4307	CLIP-seq
MIRT2002600	hsa-miR-4328	CLIP-seq
MIRT1021314	hsa-miR-4420	CLIP-seq
MIRT1021316	hsa-miR-4476	CLIP-seq
MIRT1021317	hsa-miR-4487	CLIP-seq
MIRT2002602	hsa-miR-450b-3p	CLIP-seq
MIRT1021319	hsa-miR-4515	CLIP-seq
MIRT1021320	hsa-miR-455-3p	CLIP-seq
MIRT1021321	hsa-miR-4694-3p	CLIP-seq
MIRT2235582	hsa-miR-4717-3p	CLIP-seq
MIRT2235583	hsa-miR-4720-5p	CLIP-seq
MIRT1021323	hsa-miR-4724-5p	CLIP-seq
MIRT1021325	hsa-miR-4740-5p	CLIP-seq
MIRT2002605	hsa-miR-4744	CLIP-seq
MIRT1021327	hsa-miR-4762-3p	CLIP-seq
MIRT1021328	hsa-miR-4764-5p	CLIP-seq
MIRT2235584	hsa-miR-4799-3p	CLIP-seq
MIRT2235585	hsa-miR-4799-5p	CLIP-seq
MIRT1021329	hsa-miR-494	CLIP-seq
MIRT1021331	hsa-miR-5096	CLIP-seq
MIRT1021332	hsa-miR-519d	CLIP-seq
MIRT1021333	hsa-miR-520f	CLIP-seq
MIRT1021334	hsa-miR-539	CLIP-seq
MIRT1021335	hsa-miR-548ah	CLIP-seq
MIRT2002608	hsa-miR-548u	CLIP-seq
MIRT1021336	hsa-miR-558	CLIP-seq
MIRT1021338	hsa-miR-577	CLIP-seq
MIRT2235586	hsa-miR-596	CLIP-seq
MIRT1021341	hsa-miR-605	CLIP-seq
MIRT1021342	hsa-miR-640	CLIP-seq
MIRT1021344	hsa-miR-7	CLIP-seq
MIRT2002609	hsa-miR-769-3p	CLIP-seq
MIRT2235587	hsa-miR-885-5p	CLIP-seq
MIRT2235588	hsa-miR-892b	CLIP-seq
MIRT1021345	hsa-miR-93	CLIP-seq
MIRT1021346	hsa-miR-98	CLIP-seq
MIRT1021282	hsa-miR-1245	CLIP-seq
MIRT1021290	hsa-miR-1910	CLIP-seq
MIRT2388504	hsa-miR-3680	CLIP-seq
MIRT1021314	hsa-miR-4420	CLIP-seq
MIRT1021320	hsa-miR-455-3p	CLIP-seq
MIRT2388505	hsa-miR-493	CLIP-seq
MIRT1021341	hsa-miR-605	CLIP-seq
MIRT1021342	hsa-miR-640	CLIP-seq
MIRT2235569	hsa-miR-105	CLIP-seq
MIRT1021279	hsa-miR-106a	CLIP-seq
MIRT1021280	hsa-miR-106b	CLIP-seq
MIRT2539453	hsa-miR-1207-3p	CLIP-seq
MIRT2235570	hsa-miR-1225-5p	CLIP-seq
MIRT2002580	hsa-miR-1226	CLIP-seq
MIRT2539454	hsa-miR-1229	CLIP-seq
MIRT2235571	hsa-miR-1231	CLIP-seq
MIRT1021281	hsa-miR-1243	CLIP-seq
MIRT1021283	hsa-miR-1269	CLIP-seq
MIRT1021284	hsa-miR-1269b	CLIP-seq
MIRT1021286	hsa-miR-1288	CLIP-seq
MIRT2539455	hsa-miR-1301	CLIP-seq
MIRT1021287	hsa-miR-1303	CLIP-seq
MIRT2539456	hsa-miR-1305	CLIP-seq
MIRT1021288	hsa-miR-17	CLIP-seq
MIRT2235576	hsa-miR-193a-3p	CLIP-seq
MIRT2235577	hsa-miR-193b	CLIP-seq
MIRT2539457	hsa-miR-197	CLIP-seq
MIRT2539458	hsa-miR-199a-5p	CLIP-seq
MIRT2539459	hsa-miR-199b-5p	CLIP-seq
MIRT1021292	hsa-miR-20a	CLIP-seq
MIRT1021293	hsa-miR-20b	CLIP-seq
MIRT2539460	hsa-miR-2277-3p	CLIP-seq
MIRT2002583	hsa-miR-2278	CLIP-seq
MIRT1021294	hsa-miR-23a	CLIP-seq
MIRT1021295	hsa-miR-23b	CLIP-seq
MIRT1021296	hsa-miR-23c	CLIP-seq
MIRT1021298	hsa-miR-302a	CLIP-seq
MIRT1021299	hsa-miR-302b	CLIP-seq
MIRT1021300	hsa-miR-302c	CLIP-seq
MIRT1021301	hsa-miR-302d	CLIP-seq
MIRT2539461	hsa-miR-3065-5p	CLIP-seq
MIRT2539462	hsa-miR-3123	CLIP-seq
MIRT2235578	hsa-miR-3135	CLIP-seq
MIRT1021303	hsa-miR-3136-5p	CLIP-seq
MIRT2539463	hsa-miR-3145-5p	CLIP-seq
MIRT2235579	hsa-miR-3160-5p	CLIP-seq
MIRT2002586	hsa-miR-3189-3p	CLIP-seq
MIRT2539464	hsa-miR-3192	CLIP-seq
MIRT1021305	hsa-miR-3202	CLIP-seq
MIRT2539465	hsa-miR-342-3p	CLIP-seq
MIRT2002589	hsa-miR-3545-3p	CLIP-seq
MIRT1021307	hsa-miR-3614-5p	CLIP-seq
MIRT2002591	hsa-miR-3646	CLIP-seq
MIRT2002593	hsa-miR-3657	CLIP-seq
MIRT2002594	hsa-miR-369-3p	CLIP-seq
MIRT1021308	hsa-miR-372	CLIP-seq
MIRT1021309	hsa-miR-373	CLIP-seq
MIRT2002595	hsa-miR-374a	CLIP-seq
MIRT2002596	hsa-miR-374b	CLIP-seq
MIRT2539466	hsa-miR-3925-5p	CLIP-seq
MIRT2002597	hsa-miR-3934	CLIP-seq
MIRT2002598	hsa-miR-4255	CLIP-seq
MIRT2539467	hsa-miR-4272	CLIP-seq
MIRT2235581	hsa-miR-4293	CLIP-seq
MIRT1021312	hsa-miR-4303	CLIP-seq
MIRT1021313	hsa-miR-4307	CLIP-seq
MIRT2002600	hsa-miR-4328	CLIP-seq
MIRT2539468	hsa-miR-4436b-5p	CLIP-seq
MIRT1021315	hsa-miR-4439	CLIP-seq
MIRT2539469	hsa-miR-4469	CLIP-seq
MIRT2539470	hsa-miR-4471	CLIP-seq
MIRT1021316	hsa-miR-4476	CLIP-seq
MIRT2002602	hsa-miR-450b-3p	CLIP-seq
MIRT1021318	hsa-miR-4513	CLIP-seq
MIRT1021319	hsa-miR-4515	CLIP-seq
MIRT2002603	hsa-miR-4540	CLIP-seq
MIRT1021321	hsa-miR-4694-3p	CLIP-seq
MIRT2539471	hsa-miR-4698	CLIP-seq
MIRT2235582	hsa-miR-4717-3p	CLIP-seq
MIRT2235583	hsa-miR-4720-5p	CLIP-seq
MIRT1021323	hsa-miR-4724-5p	CLIP-seq
MIRT2002604	hsa-miR-4733-3p	CLIP-seq
MIRT2539472	hsa-miR-4735-5p	CLIP-seq
MIRT1021325	hsa-miR-4740-5p	CLIP-seq
MIRT2002605	hsa-miR-4744	CLIP-seq
MIRT1021327	hsa-miR-4762-3p	CLIP-seq
MIRT1021328	hsa-miR-4764-5p	CLIP-seq
MIRT2235584	hsa-miR-4799-3p	CLIP-seq
MIRT2235585	hsa-miR-4799-5p	CLIP-seq
MIRT1021329	hsa-miR-494	CLIP-seq
MIRT2539473	hsa-miR-496	CLIP-seq
MIRT1021330	hsa-miR-499-3p	CLIP-seq
MIRT2539474	hsa-miR-5047	CLIP-seq
MIRT2539475	hsa-miR-508-5p	CLIP-seq
MIRT1021331	hsa-miR-5096	CLIP-seq
MIRT2539476	hsa-miR-518d-5p	CLIP-seq
MIRT2539477	hsa-miR-519b-5p	CLIP-seq
MIRT2539478	hsa-miR-519c-5p	CLIP-seq
MIRT1021332	hsa-miR-519d	CLIP-seq
MIRT2539479	hsa-miR-520c-5p	CLIP-seq
MIRT1021333	hsa-miR-520f	CLIP-seq
MIRT2539480	hsa-miR-526a	CLIP-seq
MIRT1021334	hsa-miR-539	CLIP-seq
MIRT1021335	hsa-miR-548ah	CLIP-seq
MIRT2002608	hsa-miR-548u	CLIP-seq
MIRT2539481	hsa-miR-556-3p	CLIP-seq
MIRT2539482	hsa-miR-561	CLIP-seq
MIRT2539483	hsa-miR-576-5p	CLIP-seq
MIRT1021338	hsa-miR-577	CLIP-seq
MIRT1021340	hsa-miR-581	CLIP-seq
MIRT2235586	hsa-miR-596	CLIP-seq
MIRT1021341	hsa-miR-605	CLIP-seq
MIRT2539484	hsa-miR-606	CLIP-seq
MIRT2539485	hsa-miR-607	CLIP-seq
MIRT1021344	hsa-miR-7	CLIP-seq
MIRT2002609	hsa-miR-769-3p	CLIP-seq
MIRT2235588	hsa-miR-892b	CLIP-seq
MIRT1021345	hsa-miR-93	CLIP-seq
MIRT2539486	hsa-miR-944	CLIP-seq
MIRT2235569	hsa-miR-105	CLIP-seq
MIRT1021279	hsa-miR-106a	CLIP-seq
MIRT1021280	hsa-miR-106b	CLIP-seq
MIRT2539453	hsa-miR-1207-3p	CLIP-seq
MIRT2235570	hsa-miR-1225-5p	CLIP-seq
MIRT2002580	hsa-miR-1226	CLIP-seq
MIRT2539454	hsa-miR-1229	CLIP-seq
MIRT2235571	hsa-miR-1231	CLIP-seq
MIRT1021281	hsa-miR-1243	CLIP-seq
MIRT1021282	hsa-miR-1245	CLIP-seq
MIRT1021283	hsa-miR-1269	CLIP-seq
MIRT1021284	hsa-miR-1269b	CLIP-seq
MIRT1021286	hsa-miR-1288	CLIP-seq
MIRT2539455	hsa-miR-1301	CLIP-seq
MIRT1021287	hsa-miR-1303	CLIP-seq
MIRT2539456	hsa-miR-1305	CLIP-seq
MIRT1021288	hsa-miR-17	CLIP-seq
MIRT1021290	hsa-miR-1910	CLIP-seq
MIRT2539458	hsa-miR-199a-5p	CLIP-seq
MIRT2539459	hsa-miR-199b-5p	CLIP-seq
MIRT1021292	hsa-miR-20a	CLIP-seq
MIRT1021293	hsa-miR-20b	CLIP-seq
MIRT2539460	hsa-miR-2277-3p	CLIP-seq
MIRT2002583	hsa-miR-2278	CLIP-seq
MIRT1021294	hsa-miR-23a	CLIP-seq
MIRT1021295	hsa-miR-23b	CLIP-seq
MIRT1021296	hsa-miR-23c	CLIP-seq
MIRT1021298	hsa-miR-302a	CLIP-seq
MIRT1021299	hsa-miR-302b	CLIP-seq
MIRT1021300	hsa-miR-302c	CLIP-seq
MIRT1021301	hsa-miR-302d	CLIP-seq
MIRT2539461	hsa-miR-3065-5p	CLIP-seq
MIRT2539462	hsa-miR-3123	CLIP-seq
MIRT2235578	hsa-miR-3135	CLIP-seq
MIRT2235579	hsa-miR-3160-5p	CLIP-seq
MIRT2002586	hsa-miR-3189-3p	CLIP-seq
MIRT2539464	hsa-miR-3192	CLIP-seq
MIRT1021305	hsa-miR-3202	CLIP-seq
MIRT2539465	hsa-miR-342-3p	CLIP-seq
MIRT2002588	hsa-miR-34b	CLIP-seq
MIRT2002589	hsa-miR-3545-3p	CLIP-seq
MIRT1021307	hsa-miR-3614-5p	CLIP-seq
MIRT2002591	hsa-miR-3646	CLIP-seq
MIRT2002593	hsa-miR-3657	CLIP-seq
MIRT1021308	hsa-miR-372	CLIP-seq
MIRT1021309	hsa-miR-373	CLIP-seq
MIRT2539466	hsa-miR-3925-5p	CLIP-seq
MIRT2002597	hsa-miR-3934	CLIP-seq
MIRT2002598	hsa-miR-4255	CLIP-seq
MIRT2235581	hsa-miR-4293	CLIP-seq
MIRT1021312	hsa-miR-4303	CLIP-seq
MIRT1021313	hsa-miR-4307	CLIP-seq
MIRT2002600	hsa-miR-4328	CLIP-seq
MIRT2539468	hsa-miR-4436b-5p	CLIP-seq
MIRT2539469	hsa-miR-4469	CLIP-seq
MIRT2539470	hsa-miR-4471	CLIP-seq
MIRT1021316	hsa-miR-4476	CLIP-seq
MIRT2002602	hsa-miR-450b-3p	CLIP-seq
MIRT1021319	hsa-miR-4515	CLIP-seq
MIRT2002603	hsa-miR-4540	CLIP-seq
MIRT1021320	hsa-miR-455-3p	CLIP-seq
MIRT2539471	hsa-miR-4698	CLIP-seq
MIRT2235582	hsa-miR-4717-3p	CLIP-seq
MIRT2002604	hsa-miR-4733-3p	CLIP-seq
MIRT2539472	hsa-miR-4735-5p	CLIP-seq
MIRT1021325	hsa-miR-4740-5p	CLIP-seq
MIRT2002605	hsa-miR-4744	CLIP-seq
MIRT1021327	hsa-miR-4762-3p	CLIP-seq
MIRT1021328	hsa-miR-4764-5p	CLIP-seq
MIRT2235585	hsa-miR-4799-5p	CLIP-seq
MIRT1021329	hsa-miR-494	CLIP-seq
MIRT2539473	hsa-miR-496	CLIP-seq
MIRT1021330	hsa-miR-499-3p	CLIP-seq
MIRT2539474	hsa-miR-5047	CLIP-seq
MIRT1021331	hsa-miR-5096	CLIP-seq
MIRT2539476	hsa-miR-518d-5p	CLIP-seq
MIRT2539477	hsa-miR-519b-5p	CLIP-seq
MIRT2539478	hsa-miR-519c-5p	CLIP-seq
MIRT1021332	hsa-miR-519d	CLIP-seq
MIRT2539479	hsa-miR-520c-5p	CLIP-seq
MIRT1021333	hsa-miR-520f	CLIP-seq
MIRT2539480	hsa-miR-526a	CLIP-seq
MIRT1021334	hsa-miR-539	CLIP-seq
MIRT1021335	hsa-miR-548ah	CLIP-seq
MIRT2002608	hsa-miR-548u	CLIP-seq
MIRT2539482	hsa-miR-561	CLIP-seq
MIRT2539483	hsa-miR-576-5p	CLIP-seq
MIRT1021338	hsa-miR-577	CLIP-seq
MIRT1021340	hsa-miR-581	CLIP-seq
MIRT2235586	hsa-miR-596	CLIP-seq
MIRT1021341	hsa-miR-605	CLIP-seq
MIRT2539484	hsa-miR-606	CLIP-seq
MIRT2539485	hsa-miR-607	CLIP-seq
MIRT1021342	hsa-miR-640	CLIP-seq
MIRT1021344	hsa-miR-7	CLIP-seq
MIRT2002609	hsa-miR-769-3p	CLIP-seq
MIRT1021345	hsa-miR-93	CLIP-seq
MIRT2539486	hsa-miR-944	CLIP-seq

Gene ontology (GO) Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004462	Function	Lactoylglutathione lyase activity	IDA	9705294, 11489834, 20454679, 23122816
GO:0004462	Function	Lactoylglutathione lyase activity	IEA
GO:0004462	Function	Lactoylglutathione lyase activity	TAS	7684374
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0005975	Process	Carbohydrate metabolic process	NAS	7684374
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006749	Process	Glutathione metabolic process	IEA
GO:0008270	Function	Zinc ion binding	IDA	9705294, 23122816
GO:0008270	Function	Zinc ion binding	IEA
GO:0009438	Process	Methylglyoxal metabolic process	IEA
GO:0016829	Function	Lyase activity	IEA
GO:0030316	Process	Osteoclast differentiation	IEA
GO:0030316	Process	Osteoclast differentiation	ISS
GO:0043066	Process	Negative regulation of apoptotic process	IDA	11489834
GO:0043066	Process	Negative regulation of apoptotic process	IMP	10807791
GO:0043066	Process	Negative regulation of apoptotic process	TAS	16130169
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145

Other IDs

• MIM: 138750
• HGNC: 4323
• e!Ensembl: ENSG00000124767

Protein

• UniProt ID: Q04760
• Protein name: Lactoylglutathione lyase (EC 4.4.1.5) (Aldoketomutase) (Glyoxalase I) (Glx I) (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase)
• Protein function: Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione (PubMed:20454679, PubMed:23122816, PubMed:9705294). Involved in the regulation of TNF-induced transcriptional activity of NF-kappa-B (P
• PDB: 1BH5 , 1FRO , 1QIN , 1QIP , 3VW9 , 3W0T , 3W0U , 7WSZ , 7WT0 , 7WT1 , 7WT2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00903	Glyoxalase	31 → 174	Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily	Domain

• Sequence:

  MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQK
  CDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNS
  DPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKM
  ATLM

• Sequence length: 184

Pathways

KEGG Pathway	Reactome Pathway
Pyruvate metabolism	Pyruvate metabolism
Metabolic pathways

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (15)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ANXIETY DISORDERS	—	CTD, Disgenet CTD, Disgenet	22113448	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism, susceptibility to, 1	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	15386471	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	CTD, Disgenet CTD, Disgenet	22113448	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	CTD	21517111	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	35835914	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	29317602	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	20093988	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DISEASES	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (147)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	16803681		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	31174324		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	20542521, 24646268, 31059718		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	16352396, 18455873, 20542521, 24646268, 31059718		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety Disorders	Anxiety Disorder	CTD_human_DG	22113448		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety States, Neurotic	Anxiety Disorder	CTD_human_DG	22113448		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	19412133, 25139743		★☆☆☆☆ Found in Text Mining only
Ataxia, Spinocerebellar	Spinocerebellar Ataxia	BEFREE	1675045		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	19412133, 25139743		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	24767709, 27478003	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	17722011, 24671236, 25201284		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	15386471, 17346350, 17722011, 18721844, 21491613, 25201284		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	15386471		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	15386471, 17346350	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Azoospermia	Azoospermia	Pubtator	37283758	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	18455873		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	18455873		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	31630312		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	31369791		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11368412, 16048908, 19379515, 19452310, 20712647, 22614840, 26618552, 28695773, 30559934		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16048908, 19379515, 26618552, 28695773, 36998085	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12204678, 31630312		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31484776	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31630312		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25407489	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	24767709	Inhibit	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	21294693		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	27478003	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31420161		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	28231326, 29156655		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	20544845, 28903386		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26931562		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26931562	Associate	★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia	Congenital adrenal hyperplasia	BEFREE	3493216, 6130199, 6286442		★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Congenital adrenal hyperplasia	BEFREE	6130199, 6286442, 692595		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	31534514		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30635030		★☆☆☆☆ Found in Text Mining only
Depression, Neurotic	Mental Depression	CTD_human_DG	22113448		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	15858064		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	CTD_human_DG	22113448		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	28322281, 30628789		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Syndrome	Mental Depression	CTD_human_DG	22113448		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	18413187, 20093988, 20186387, 21056979, 22143324, 23201419, 23360186, 24259499, 24646254, 27318675, 28106778, 29783710, 30062553, 30179128, 31369791		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	38027126	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	18413187, 20093988, 20186387, 21056979, 21370249, 22143324, 23201419, 23360186, 24259499, 24646254, 27318675, 28106778, 29783710, 30062553, 30179128, 30342159, 31369791, 31512318, 6892568		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	18413187, 20093988, 24908234, 29783710, 38027126	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	37671166	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18413187	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	1757272, 31512318, 6892568, 6955994		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	18413187, 19412133, 21294693, 21370249, 21738003, 23775136, 29046313		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	39336582	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29477239, 30841430		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	29690804		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	16505483		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	16505483	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endogenous depression	Mental Depression	CTD_human_DG	22113448		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	22540333, 30849641		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	21270604, 30849641	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	27000251		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	7608125		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30684449		★☆☆☆☆ Found in Text Mining only
Gastro-enteropancreatic neuroendocrine tumor	Digestive system neuroendocrine neoplasm	BEFREE	30908205		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	17233837	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29385725		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29385725		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	20544845, 31738028		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	20544845, 33885248	Associate	★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	20544845	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	6892568		★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	718142		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	20544845	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	18079478, 20185929		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	18079478, 20185929		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	21056979, 22143324, 28106778, 30287091, 31512318, 31534514		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31420161		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27999356	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	12204678		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	21738003		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	25407489	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10807791	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17786358, 24966916, 29156655, 31482070, 31738028		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	28231326, 29156655		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	3187991		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22479608	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11368412, 16048908, 19379515, 19452310, 20712647, 22614840, 26618552, 28695773, 30559934		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	22540333, 30849641		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	25407489		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	20398646, 31738028		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11164178, 27696457, 28929505, 29504694		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22479608, 24662817		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31630312		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12708468, 19452310, 20544845, 20712647, 21370249, 22479608, 24646254, 24646268, 26618552, 27999356, 28169168, 28506645, 28695773, 28903386, 28929505, 29385039, 29385725, 30686140, 31174324, 31482070, 31630312, 31738028, 31811141, 6572551		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	20544845, 28903386		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16048908, 22614840		★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	CTD_human_DG	22113448		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	20093988, 29307109		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	CTD_human_DG	20093988		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	20093988	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	15858064, 18455873		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	18455873, 28322281, 30628789		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitochondrial Diseases	Mitochondrial disease	Pubtator	33966051	Associate	★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	18455873		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	LHGDN	18455873		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	30470837		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	17463067		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	17463067		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28864889		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	31534514		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12708468, 19379515, 22614840, 24646254, 24646268, 24662817, 24966916, 24978626, 25407489, 27999356, 28117708, 28282916, 28506645, 28903386, 28929505, 29100361, 29385725, 29504694, 30559934, 31738028, 31794195, 31811141, 7619046		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	1974661		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	15128939		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24646254, 24646268		★☆☆☆☆ Found in Text Mining only
Oligodendroglioma	Oligodendroglioma	Pubtator	17264672	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29355739		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	30445774, 38364892	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	20398646, 31738028		★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	31661534	Associate	★☆☆☆☆ Found in Text Mining only
Panic Attacks	Panic Disorder	BEFREE	20542521		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	16352396		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	LHGDN	16352396		★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	24671236		★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	28467603		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11164178, 27696457, 28929505, 29504694		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18344682		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19893039, 24040147, 29504694	Associate	★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	25407489		★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Restless Legs Syndrome	BEFREE	26298793		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	21738003		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	30099685		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	20544845, 35143416	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20530008, 25645869, 29975244		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	20530008		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	30223524		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	29690804		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 1	Spinocerebellar Ataxia	BEFREE	1675045, 7438789		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	CTD_human_DG	21517111		★☆☆☆☆ Found in Text Mining only
Steroid-sensitive nephrotic syndrome	Steroid-Sensitive Nephrotic Syndrome	BEFREE	1974661		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22479608, 24662817		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20544845, 22479608	Associate	★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	30223524		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	30223524		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	31174324	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36998085	Associate	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	CTD_human_DG	22113448		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	20544845	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	24908234	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular System Injuries	Vascular system injury	Pubtator	27898103	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

PAM 2 shared diseasesAnxiety disorder, Diabetic retinopathy 3 shared evidence sourcesDisgenet (Anxiety disorder), CTD (Anxiety disorder), Disgenet (Diabetes mellitus type 2) Related via 2 shared diseases including Anxiety disorder, Diabetic retinopathy — evidence mostly Disgenet. ACE2 2 shared diseasesAnxiety disorder, Diabetic retinopathy 3 shared evidence sourcesDisgenet (Anxiety disorder), CTD (Anxiety disorder), Disgenet (Diabetic retinopathy) Related via 2 shared diseases including Anxiety disorder, Diabetic retinopathy — evidence mostly Disgenet. GUCY1A2 2 shared diseasesAnxiety disorder, Vascular disease Related via 2 shared diseases including Anxiety disorder, Vascular disease. GRM8 2 shared diseasesAnxiety disorder, Diabetic retinopathy 2 shared evidence sourcesDisgenet (Anxiety disorder), CTD (Anxiety disorder) Related via 2 shared diseases including Anxiety disorder, Diabetic retinopathy — evidence mostly Disgenet. CLIC1 2 shared diseasesAnxiety disorder, Esophageal squamous cell carcinoma 1 shared evidence sourceCTD (Esophageal squamous cell carcinoma) Related via 2 shared diseases including Anxiety disorder, Esophageal squamous cell carcinoma — evidence mostly CTD.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PAM	2	["Anxiety disorder","Diabetic retinopathy"]	0	[]	3	["Disgenet (Anxiety disorder)","CTD (Anxiety disorder)","Disgenet (Diabetes mellitus type 2)"]
ACE2	2	["Anxiety disorder","Diabetic retinopathy"]	0	[]	3	["Disgenet (Anxiety disorder)","CTD (Anxiety disorder)","Disgenet (Diabetic retinopathy)"]
GUCY1A2	2	["Anxiety disorder","Vascular disease"]	0	[]	0	[]
GRM8	2	["Anxiety disorder","Diabetic retinopathy"]	0	[]	2	["Disgenet (Anxiety disorder)","CTD (Anxiety disorder)"]
CLIC1	2	["Anxiety disorder","Esophageal squamous cell carcinoma"]	0	[]	1	["CTD (Esophageal squamous cell carcinoma)"]

Diseases Linked via Similar Genes

Osteoarthritis Linked via 2 of 5 related genesPAM, CLIC1 Parkinson disease Linked via 2 of 5 related genesPAM, GUCY1A2 Breast neoplasms Linked via 2 of 5 related genesGUCY1A2, CLIC1 Obesity Linked via 2 of 5 related genesGUCY1A2, GRM8 Neurotic disorder Linked via 2 of 5 related genesGRM8, CLIC1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Osteoarthritis	2	["PAM","CLIC1"]
Parkinson disease	2	["PAM","GUCY1A2"]
Breast neoplasms	2	["GUCY1A2","CLIC1"]
Obesity	2	["GUCY1A2","GRM8"]
Neurotic disorder	2	["GRM8","CLIC1"]