GCLM (glutamate-cysteine ligase modifier subunit)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 2730
• Gene name: Glutamate-cysteine ligase modifier subunit
• Gene symbol: GCLM
• Synonyms (NCBI Gene): GLCLR
• Chromosome: 1
• Chromosome location: 1p22.1
• Summary: Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine s

miRNA Show/Hide all (298)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051314	hsa-miR-15a-5p	CLASH	23622248
MIRT050382	hsa-miR-24-3p	CLASH	23622248
MIRT638687	hsa-miR-4781-3p	HITS-CLIP	23824327
MIRT638686	hsa-miR-3155a	HITS-CLIP	23824327
MIRT638685	hsa-miR-3155b	HITS-CLIP	23824327
MIRT638684	hsa-miR-484	HITS-CLIP	23824327
MIRT638683	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT638682	hsa-miR-373-5p	HITS-CLIP	23824327
MIRT638681	hsa-miR-616-5p	HITS-CLIP	23824327
MIRT638680	hsa-miR-371a-5p	HITS-CLIP	23824327
MIRT638679	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT638678	hsa-miR-3663-5p	HITS-CLIP	23824327
MIRT638677	hsa-miR-6131	HITS-CLIP	23824327
MIRT638676	hsa-miR-6801-5p	HITS-CLIP	23824327
MIRT638675	hsa-miR-5587-5p	HITS-CLIP	23824327
MIRT638674	hsa-miR-6843-3p	HITS-CLIP	23824327
MIRT638673	hsa-miR-6848-3p	HITS-CLIP	23824327
MIRT638687	hsa-miR-4781-3p	HITS-CLIP	23824327
MIRT638686	hsa-miR-3155a	HITS-CLIP	23824327
MIRT638685	hsa-miR-3155b	HITS-CLIP	23824327
MIRT638684	hsa-miR-484	HITS-CLIP	23824327
MIRT638683	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT638682	hsa-miR-373-5p	HITS-CLIP	23824327
MIRT638681	hsa-miR-616-5p	HITS-CLIP	23824327
MIRT638680	hsa-miR-371a-5p	HITS-CLIP	23824327
MIRT638679	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT638678	hsa-miR-3663-5p	HITS-CLIP	23824327
MIRT638677	hsa-miR-6131	HITS-CLIP	23824327
MIRT638676	hsa-miR-6801-5p	HITS-CLIP	23824327
MIRT638675	hsa-miR-5587-5p	HITS-CLIP	23824327
MIRT638674	hsa-miR-6843-3p	HITS-CLIP	23824327
MIRT638673	hsa-miR-6848-3p	HITS-CLIP	23824327
MIRT1014801	hsa-miR-122	CLIP-seq
MIRT1014802	hsa-miR-1224-3p	CLIP-seq
MIRT1014803	hsa-miR-125a-3p	CLIP-seq
MIRT1014804	hsa-miR-1273f	CLIP-seq
MIRT1014805	hsa-miR-1281	CLIP-seq
MIRT1014806	hsa-miR-1289	CLIP-seq
MIRT1014807	hsa-miR-129-5p	CLIP-seq
MIRT1014808	hsa-miR-1307	CLIP-seq
MIRT1014809	hsa-miR-130a	CLIP-seq
MIRT1014810	hsa-miR-130b	CLIP-seq
MIRT1014811	hsa-miR-143	CLIP-seq
MIRT1014812	hsa-miR-1913	CLIP-seq
MIRT1014813	hsa-miR-1915	CLIP-seq
MIRT1014814	hsa-miR-301a	CLIP-seq
MIRT1014815	hsa-miR-301b	CLIP-seq
MIRT1014816	hsa-miR-3135b	CLIP-seq
MIRT1014817	hsa-miR-3155	CLIP-seq
MIRT1014818	hsa-miR-3198	CLIP-seq
MIRT1014819	hsa-miR-324-3p	CLIP-seq
MIRT1014820	hsa-miR-3652	CLIP-seq
MIRT1014821	hsa-miR-3666	CLIP-seq
MIRT1014822	hsa-miR-371-5p	CLIP-seq
MIRT1014823	hsa-miR-3934	CLIP-seq
MIRT1014824	hsa-miR-4284	CLIP-seq
MIRT1014825	hsa-miR-4294	CLIP-seq
MIRT1014826	hsa-miR-4295	CLIP-seq
MIRT1014827	hsa-miR-4309	CLIP-seq
MIRT1014828	hsa-miR-4430	CLIP-seq
MIRT1014829	hsa-miR-4534	CLIP-seq
MIRT1014830	hsa-miR-454	CLIP-seq
MIRT1014831	hsa-miR-4638-5p	CLIP-seq
MIRT1014832	hsa-miR-4695-3p	CLIP-seq
MIRT1014833	hsa-miR-4708-5p	CLIP-seq
MIRT1014834	hsa-miR-4726-3p	CLIP-seq
MIRT1014835	hsa-miR-4770	CLIP-seq
MIRT1014836	hsa-miR-498	CLIP-seq
MIRT1014837	hsa-miR-720	CLIP-seq
MIRT1014838	hsa-miR-764	CLIP-seq
MIRT2000458	hsa-miR-1206	CLIP-seq
MIRT2000459	hsa-miR-1208	CLIP-seq
MIRT1014801	hsa-miR-122	CLIP-seq
MIRT2000460	hsa-miR-1246	CLIP-seq
MIRT1014804	hsa-miR-1273f	CLIP-seq
MIRT1014805	hsa-miR-1281	CLIP-seq
MIRT1014806	hsa-miR-1289	CLIP-seq
MIRT1014808	hsa-miR-1307	CLIP-seq
MIRT1014811	hsa-miR-143	CLIP-seq
MIRT2000461	hsa-miR-150	CLIP-seq
MIRT2000462	hsa-miR-190	CLIP-seq
MIRT2000463	hsa-miR-190b	CLIP-seq
MIRT1014813	hsa-miR-1915	CLIP-seq
MIRT2000464	hsa-miR-1976	CLIP-seq
MIRT2000465	hsa-miR-23a	CLIP-seq
MIRT2000466	hsa-miR-23b	CLIP-seq
MIRT2000467	hsa-miR-23c	CLIP-seq
MIRT2000468	hsa-miR-28-3p	CLIP-seq
MIRT1014816	hsa-miR-3135b	CLIP-seq
MIRT2000469	hsa-miR-3150a-5p	CLIP-seq
MIRT2000470	hsa-miR-3150b-5p	CLIP-seq
MIRT1014818	hsa-miR-3198	CLIP-seq
MIRT1014820	hsa-miR-3652	CLIP-seq
MIRT2000471	hsa-miR-3942-5p	CLIP-seq
MIRT2000472	hsa-miR-425	CLIP-seq
MIRT2000473	hsa-miR-4257	CLIP-seq
MIRT2000474	hsa-miR-4279	CLIP-seq
MIRT1014824	hsa-miR-4284	CLIP-seq
MIRT1014825	hsa-miR-4294	CLIP-seq
MIRT1014827	hsa-miR-4309	CLIP-seq
MIRT2000475	hsa-miR-433	CLIP-seq
MIRT1014828	hsa-miR-4430	CLIP-seq
MIRT2000476	hsa-miR-4438	CLIP-seq
MIRT2000477	hsa-miR-4477b	CLIP-seq
MIRT2000478	hsa-miR-4532	CLIP-seq
MIRT1014829	hsa-miR-4534	CLIP-seq
MIRT1014831	hsa-miR-4638-5p	CLIP-seq
MIRT1014832	hsa-miR-4695-3p	CLIP-seq
MIRT2000479	hsa-miR-4699-3p	CLIP-seq
MIRT2000480	hsa-miR-4703-5p	CLIP-seq
MIRT1014833	hsa-miR-4708-5p	CLIP-seq
MIRT2000481	hsa-miR-4715-3p	CLIP-seq
MIRT2000482	hsa-miR-4722-3p	CLIP-seq
MIRT1014834	hsa-miR-4726-3p	CLIP-seq
MIRT1014835	hsa-miR-4770	CLIP-seq
MIRT2000483	hsa-miR-4797-5p	CLIP-seq
MIRT1014836	hsa-miR-498	CLIP-seq
MIRT2000484	hsa-miR-5095	CLIP-seq
MIRT2000485	hsa-miR-562	CLIP-seq
MIRT2000486	hsa-miR-580	CLIP-seq
MIRT2000487	hsa-miR-590-3p	CLIP-seq
MIRT1014837	hsa-miR-720	CLIP-seq
MIRT2000488	hsa-miR-935	CLIP-seq
MIRT2000459	hsa-miR-1208	CLIP-seq
MIRT1014801	hsa-miR-122	CLIP-seq
MIRT1014802	hsa-miR-1224-3p	CLIP-seq
MIRT2233989	hsa-miR-1252	CLIP-seq
MIRT1014804	hsa-miR-1273f	CLIP-seq
MIRT1014805	hsa-miR-1281	CLIP-seq
MIRT1014806	hsa-miR-1289	CLIP-seq
MIRT1014808	hsa-miR-1307	CLIP-seq
MIRT2233990	hsa-miR-145	CLIP-seq
MIRT2000461	hsa-miR-150	CLIP-seq
MIRT1014812	hsa-miR-1913	CLIP-seq
MIRT2000464	hsa-miR-1976	CLIP-seq
MIRT2233991	hsa-miR-2054	CLIP-seq
MIRT2233992	hsa-miR-2682	CLIP-seq
MIRT2000468	hsa-miR-28-3p	CLIP-seq
MIRT1014816	hsa-miR-3135b	CLIP-seq
MIRT2233993	hsa-miR-3148	CLIP-seq
MIRT2233994	hsa-miR-3149	CLIP-seq
MIRT2000469	hsa-miR-3150a-5p	CLIP-seq
MIRT2000470	hsa-miR-3150b-5p	CLIP-seq
MIRT1014817	hsa-miR-3155	CLIP-seq
MIRT1014818	hsa-miR-3198	CLIP-seq
MIRT1014819	hsa-miR-324-3p	CLIP-seq
MIRT1014820	hsa-miR-3652	CLIP-seq
MIRT1014822	hsa-miR-371-5p	CLIP-seq
MIRT1014823	hsa-miR-3934	CLIP-seq
MIRT2233995	hsa-miR-3973	CLIP-seq
MIRT2233996	hsa-miR-411	CLIP-seq
MIRT2233997	hsa-miR-4258	CLIP-seq
MIRT2000474	hsa-miR-4279	CLIP-seq
MIRT1014824	hsa-miR-4284	CLIP-seq
MIRT1014825	hsa-miR-4294	CLIP-seq
MIRT1014827	hsa-miR-4309	CLIP-seq
MIRT2233998	hsa-miR-4328	CLIP-seq
MIRT1014828	hsa-miR-4430	CLIP-seq
MIRT2000476	hsa-miR-4438	CLIP-seq
MIRT2233999	hsa-miR-449c	CLIP-seq
MIRT2234000	hsa-miR-4514	CLIP-seq
MIRT2234001	hsa-miR-4524	CLIP-seq
MIRT2000478	hsa-miR-4532	CLIP-seq
MIRT1014829	hsa-miR-4534	CLIP-seq
MIRT1014831	hsa-miR-4638-5p	CLIP-seq
MIRT2234002	hsa-miR-4692	CLIP-seq
MIRT1014832	hsa-miR-4695-3p	CLIP-seq
MIRT2234003	hsa-miR-4700-3p	CLIP-seq
MIRT2234004	hsa-miR-4707-3p	CLIP-seq
MIRT2234005	hsa-miR-4712-5p	CLIP-seq
MIRT2234006	hsa-miR-4716-5p	CLIP-seq
MIRT2000482	hsa-miR-4722-3p	CLIP-seq
MIRT2234007	hsa-miR-4735-5p	CLIP-seq
MIRT2234008	hsa-miR-4775	CLIP-seq
MIRT2234009	hsa-miR-4778-3p	CLIP-seq
MIRT2234010	hsa-miR-4794	CLIP-seq
MIRT1014836	hsa-miR-498	CLIP-seq
MIRT2000484	hsa-miR-5095	CLIP-seq
MIRT2234011	hsa-miR-512-3p	CLIP-seq
MIRT2234012	hsa-miR-552	CLIP-seq
MIRT2000485	hsa-miR-562	CLIP-seq
MIRT2000487	hsa-miR-590-3p	CLIP-seq
MIRT1014837	hsa-miR-720	CLIP-seq
MIRT2234013	hsa-miR-770-5p	CLIP-seq
MIRT2000459	hsa-miR-1208	CLIP-seq
MIRT1014805	hsa-miR-1281	CLIP-seq
MIRT2000469	hsa-miR-3150a-5p	CLIP-seq
MIRT2000470	hsa-miR-3150b-5p	CLIP-seq
MIRT2000478	hsa-miR-4532	CLIP-seq
MIRT1014836	hsa-miR-498	CLIP-seq
MIRT2000458	hsa-miR-1206	CLIP-seq
MIRT2000471	hsa-miR-3942-5p	CLIP-seq
MIRT2000473	hsa-miR-4257	CLIP-seq
MIRT2429292	hsa-miR-4275	CLIP-seq
MIRT2000475	hsa-miR-433	CLIP-seq
MIRT2000477	hsa-miR-4477b	CLIP-seq
MIRT2000480	hsa-miR-4703-5p	CLIP-seq
MIRT2000483	hsa-miR-4797-5p	CLIP-seq
MIRT2429293	hsa-miR-570	CLIP-seq
MIRT2000486	hsa-miR-580	CLIP-seq
MIRT1014805	hsa-miR-1281	CLIP-seq
MIRT2000461	hsa-miR-150	CLIP-seq
MIRT2000464	hsa-miR-1976	CLIP-seq
MIRT2000469	hsa-miR-3150a-5p	CLIP-seq
MIRT2000470	hsa-miR-3150b-5p	CLIP-seq
MIRT2000474	hsa-miR-4279	CLIP-seq
MIRT2000478	hsa-miR-4532	CLIP-seq
MIRT2000482	hsa-miR-4722-3p	CLIP-seq
MIRT1014836	hsa-miR-498	CLIP-seq
MIRT1014805	hsa-miR-1281	CLIP-seq
MIRT2000461	hsa-miR-150	CLIP-seq
MIRT2000464	hsa-miR-1976	CLIP-seq
MIRT2000469	hsa-miR-3150a-5p	CLIP-seq
MIRT2000470	hsa-miR-3150b-5p	CLIP-seq
MIRT2000474	hsa-miR-4279	CLIP-seq
MIRT2000478	hsa-miR-4532	CLIP-seq
MIRT2000482	hsa-miR-4722-3p	CLIP-seq
MIRT1014836	hsa-miR-498	CLIP-seq
MIRT1014801	hsa-miR-122	CLIP-seq
MIRT2233989	hsa-miR-1252	CLIP-seq
MIRT1014804	hsa-miR-1273f	CLIP-seq
MIRT2537889	hsa-miR-1279	CLIP-seq
MIRT1014805	hsa-miR-1281	CLIP-seq
MIRT1014808	hsa-miR-1307	CLIP-seq
MIRT2233990	hsa-miR-145	CLIP-seq
MIRT2000461	hsa-miR-150	CLIP-seq
MIRT1014813	hsa-miR-1915	CLIP-seq
MIRT2000464	hsa-miR-1976	CLIP-seq
MIRT2233992	hsa-miR-2682	CLIP-seq
MIRT2000468	hsa-miR-28-3p	CLIP-seq
MIRT1014816	hsa-miR-3135b	CLIP-seq
MIRT2233993	hsa-miR-3148	CLIP-seq
MIRT2233994	hsa-miR-3149	CLIP-seq
MIRT2000469	hsa-miR-3150a-5p	CLIP-seq
MIRT2000470	hsa-miR-3150b-5p	CLIP-seq
MIRT2537890	hsa-miR-3170	CLIP-seq
MIRT1014820	hsa-miR-3652	CLIP-seq
MIRT2537891	hsa-miR-3941	CLIP-seq
MIRT2233996	hsa-miR-411	CLIP-seq
MIRT2233997	hsa-miR-4258	CLIP-seq
MIRT2000474	hsa-miR-4279	CLIP-seq
MIRT1014828	hsa-miR-4430	CLIP-seq
MIRT2000476	hsa-miR-4438	CLIP-seq
MIRT2233999	hsa-miR-449c	CLIP-seq
MIRT2234000	hsa-miR-4514	CLIP-seq
MIRT2234001	hsa-miR-4524	CLIP-seq
MIRT2000478	hsa-miR-4532	CLIP-seq
MIRT1014831	hsa-miR-4638-5p	CLIP-seq
MIRT2537892	hsa-miR-4643	CLIP-seq
MIRT2537893	hsa-miR-466	CLIP-seq
MIRT2537894	hsa-miR-4672	CLIP-seq
MIRT2234002	hsa-miR-4692	CLIP-seq
MIRT1014832	hsa-miR-4695-3p	CLIP-seq
MIRT2234004	hsa-miR-4707-3p	CLIP-seq
MIRT2234005	hsa-miR-4712-5p	CLIP-seq
MIRT2000481	hsa-miR-4715-3p	CLIP-seq
MIRT2234006	hsa-miR-4716-5p	CLIP-seq
MIRT2000482	hsa-miR-4722-3p	CLIP-seq
MIRT1014834	hsa-miR-4726-3p	CLIP-seq
MIRT2234007	hsa-miR-4735-5p	CLIP-seq
MIRT2537895	hsa-miR-4768-5p	CLIP-seq
MIRT2234008	hsa-miR-4775	CLIP-seq
MIRT2234009	hsa-miR-4778-3p	CLIP-seq
MIRT2537896	hsa-miR-4789-3p	CLIP-seq
MIRT2234010	hsa-miR-4794	CLIP-seq
MIRT1014836	hsa-miR-498	CLIP-seq
MIRT2000484	hsa-miR-5095	CLIP-seq
MIRT2000485	hsa-miR-562	CLIP-seq
MIRT2000487	hsa-miR-590-3p	CLIP-seq
MIRT2234013	hsa-miR-770-5p	CLIP-seq
MIRT1014801	hsa-miR-122	CLIP-seq
MIRT1014805	hsa-miR-1281	CLIP-seq
MIRT1014808	hsa-miR-1307	CLIP-seq
MIRT2000461	hsa-miR-150	CLIP-seq
MIRT1014813	hsa-miR-1915	CLIP-seq
MIRT2000464	hsa-miR-1976	CLIP-seq
MIRT1014816	hsa-miR-3135b	CLIP-seq
MIRT2233994	hsa-miR-3149	CLIP-seq
MIRT2000469	hsa-miR-3150a-5p	CLIP-seq
MIRT2000470	hsa-miR-3150b-5p	CLIP-seq
MIRT1014820	hsa-miR-3652	CLIP-seq
MIRT2233997	hsa-miR-4258	CLIP-seq
MIRT2000474	hsa-miR-4279	CLIP-seq
MIRT1014824	hsa-miR-4284	CLIP-seq
MIRT1014828	hsa-miR-4430	CLIP-seq
MIRT2234001	hsa-miR-4524	CLIP-seq
MIRT2000478	hsa-miR-4532	CLIP-seq
MIRT1014831	hsa-miR-4638-5p	CLIP-seq
MIRT1014832	hsa-miR-4695-3p	CLIP-seq
MIRT2234004	hsa-miR-4707-3p	CLIP-seq
MIRT2000482	hsa-miR-4722-3p	CLIP-seq
MIRT1014834	hsa-miR-4726-3p	CLIP-seq
MIRT2234007	hsa-miR-4735-5p	CLIP-seq
MIRT2234008	hsa-miR-4775	CLIP-seq
MIRT2234010	hsa-miR-4794	CLIP-seq
MIRT1014836	hsa-miR-498	CLIP-seq
MIRT2000485	hsa-miR-562	CLIP-seq
MIRT2000487	hsa-miR-590-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004357	Function	Glutamate-cysteine ligase activity	IEA
GO:0004357	Function	Glutamate-cysteine ligase activity	IMP	16183645
GO:0005515	Function	Protein binding	IPI	9675072, 28514442, 32296183, 33961781
GO:0005829	Component	Cytosol	NAS	9895302
GO:0005829	Component	Cytosol	TAS
GO:0006534	Process	Cysteine metabolic process	IEA
GO:0006536	Process	Glutamate metabolic process	IDA	9841880, 9895302
GO:0006749	Process	Glutathione metabolic process	IEA
GO:0006750	Process	Glutathione biosynthetic process	IBA
GO:0006750	Process	Glutathione biosynthetic process	IDA	9675072, 10395918
GO:0006750	Process	Glutathione biosynthetic process	IEA
GO:0006750	Process	Glutathione biosynthetic process	IEA
GO:0006750	Process	Glutathione biosynthetic process	IMP	12081989
GO:0006979	Process	Response to oxidative stress	IDA	10395918
GO:0006979	Process	Response to oxidative stress	IEA
GO:0006979	Process	Response to oxidative stress	IEA
GO:0007584	Process	Response to nutrient	IEA
GO:0008637	Process	Apoptotic mitochondrial changes	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IDA	9895302
GO:0014823	Process	Response to activity	IEA
GO:0017109	Component	Glutamate-cysteine ligase complex	IBA
GO:0017109	Component	Glutamate-cysteine ligase complex	IDA	9675072, 9841880
GO:0017109	Component	Glutamate-cysteine ligase complex	IEA
GO:0035226	Function	Glutamate-cysteine ligase catalytic subunit binding	IBA
GO:0035226	Function	Glutamate-cysteine ligase catalytic subunit binding	IEA
GO:0035226	Function	Glutamate-cysteine ligase catalytic subunit binding	IPI	9675072, 9841880
GO:0035729	Process	Cellular response to hepatocyte growth factor stimulus	IEA
GO:0035733	Process	Hepatic stellate cell activation	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0044344	Process	Cellular response to fibroblast growth factor stimulus	IEA
GO:0044752	Process	Response to human chorionic gonadotropin	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0051409	Process	Response to nitrosative stress	IEA
GO:0051900	Process	Regulation of mitochondrial depolarization	IEA
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0071372	Process	Cellular response to follicle-stimulating hormone stimulus	IEA
GO:0097069	Process	Cellular response to thyroxine stimulus	IEA
GO:0097746	Process	Blood vessel diameter maintenance	IMP	12975258
GO:1990609	Function	Glutamate-cysteine ligase regulator activity	IBA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	IEA

Other IDs

• MIM: 601176
• HGNC: 4312
• e!Ensembl: ENSG00000023909

Protein

• UniProt ID: P48507
• Protein name: Glutamate--cysteine ligase regulatory subunit (GCS light chain) (Gamma-ECS regulatory subunit) (Gamma-glutamylcysteine synthetase regulatory subunit) (Glutamate--cysteine ligase modifier subunit)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00248	Aldo_ket_red	70 → 241	Aldo/keto reductase family	Domain

• Tissue specificity: TISSUE SPECIFICITY: In all tissues examined. Highest levels in skeletal muscle.
• Sequence:

  MGTDSRAAKALLARARTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNEWSSQINP
  DLVREFPDVLECTVSHAVEKINPDEREEMKVSAKLFIVESNSSSSTRSAVDMACSVLGVA
  QLDSVIIASPPIEDGVNLSLEHLQPYWEELENLVQSKKIVAIGTSDLDKTQLEQLYQWAQ
  VKPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQESIPDIQAH
  EWVPLWLLRYSVIVKSRGIIKSKGYILQAKRRGS

• Sequence length: 274

Pathways

KEGG Pathway	Reactome Pathway
Cysteine and methionine metabolism	Glutathione synthesis and recycling
Glutathione metabolism	Defective GCLC causes Hemolytic anemia due to gamma-glutamylcysteine synthetase deficiency (HAGGSD)
Metabolic pathways
Biosynthesis of cofactors
Ferroptosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (6)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
BERYLLIOSIS	—	CTD	16766924	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA, VASCULAR	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	32715377	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	12081989, 12975258	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial infarction, susceptibility to	risk factor	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (60)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	15254739		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	11774239		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	11774239		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	31271759		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	29307609		★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic	Anemia	BEFREE	10515893, 10733484		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	19126404		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	17643973		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	19126404		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29440447	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11774239		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35841206	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11911273, 9245699		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	7671249		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	23129588		★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	17331133		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	10802223, 20732852		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11097346, 11500053		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11774239, 8705999, 9679568		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	12975258		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	24933031		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	38287255	Associate	★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	34722766	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	9626582		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	9626582		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	9345268		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	28755973		★☆☆☆☆ Found in Text Mining only
Ichthyosis Vulgaris	Ichthyosis vulgaris	Pubtator	20664557	Stimulate	★☆☆☆☆ Found in Text Mining only
Intestinal Volvulus	Intestinal Volvulus	BEFREE	11163433		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	16239001		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29549912		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	14532974		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	9841137		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11911273, 9245699, 9569044		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	7671249		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11097346, 11687904, 25620030		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11097346, 11500053, 11687904		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	9495245, 9841137		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	23152058	Associate	★☆☆☆☆ Found in Text Mining only
Mutilating keratoderma	Mutilating Keratoderma	BEFREE	10940652		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	12081989, 21504558		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	12081989, 12975258		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	LHGDN	12081989		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	28757675	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	28757675		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24802641, 7671249, 8705999, 9569044		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28681934		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16012725		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	7671249		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	29852184		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	1355406		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	16909399		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18449862, 18991850, 19455074		★☆☆☆☆ Found in Text Mining only
Shared Paranoid Disorder	Shared Paranoid Disorder	BEFREE	18991850		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	16012725		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	15254739, 9268987		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	31351176		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29440447		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	29440447	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34418989, 37108769	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

GCLC 6 shared pathwaysCysteine and methionine metabolism, Glutathione metabolism, Biosynthesis of cofactors, Ferroptosis, Glutathione synthesis and recycling, Defective GCLC causes Hemolytic anemia due to gamma-glutamylcysteine synthetase deficiency (HAGGSD) 5 shared evidence sourcesDisgenet (Diabetes mellitus type 2), CTD (Diabetes mellitus type 2), CTD (Myocardial infarction), Disgenet (Myocardial infarction), ClinVar (Myocardial infarction) Related via 6 shared pathways including Cysteine and methionine metabolism, Glutathione metabolism — evidence mostly Disgenet. GSS 5 shared pathwaysCysteine and methionine metabolism, Glutathione metabolism, Biosynthesis of cofactors, Ferroptosis, Glutathione synthesis and recycling Related via 5 shared pathways including Cysteine and methionine metabolism, Glutathione metabolism. LGALS2 3 shared evidence sourcesCTD (Myocardial infarction), Disgenet (Myocardial infarction), ClinVar (Myocardial infarction) Related via 3 shared evidence sources. EPC2 2 shared evidence sourcesDisgenet (Diabetes mellitus type 2), CTD (Diabetes mellitus type 2) Related via 2 shared evidence sources. KCNK16 2 shared evidence sourcesDisgenet (Diabetes mellitus type 2), CTD (Diabetes mellitus type 2) Related via 2 shared evidence sources.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
GCLC	0	[]	6	["Cysteine and methionine metabolism","Glutathione metabolism","Biosynthesis of cofactors","Ferroptosis","Glutathione synthesis and recycling","Defective GCLC causes Hemolytic anemia due to gamma-glutamylcysteine synthetase deficiency (HAGGSD)"]	5	["Disgenet (Diabetes mellitus type 2)","CTD (Diabetes mellitus type 2)","CTD (Myocardial infarction)","Disgenet (Myocardial infarction)","ClinVar (Myocardial infarction)"]
GSS	0	[]	5	["Cysteine and methionine metabolism","Glutathione metabolism","Biosynthesis of cofactors","Ferroptosis","Glutathione synthesis and recycling"]	0	[]
LGALS2	0	[]	0	[]	3	["CTD (Myocardial infarction)","Disgenet (Myocardial infarction)","ClinVar (Myocardial infarction)"]
EPC2	0	[]	0	[]	2	["Disgenet (Diabetes mellitus type 2)","CTD (Diabetes mellitus type 2)"]
KCNK16	0	[]	0	[]	2	["Disgenet (Diabetes mellitus type 2)","CTD (Diabetes mellitus type 2)"]

Diseases Linked via Similar Genes

Schizophrenia Linked via 3 of 5 related genesGCLC, GSS, EPC2 Congenital nonspherocytic hemolytic anemia Linked via 2 of 5 related genesGCLC, GSS Contact dermatitis Linked via 2 of 5 related genesGCLC, GSS Hereditary hemolytic anemia Linked via 2 of 5 related genesGCLC, GSS Alzheimer disease Linked via 2 of 5 related genesGSS, EPC2

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Schizophrenia	3	["GCLC","GSS","EPC2"]
Congenital nonspherocytic hemolytic anemia	2	["GCLC","GSS"]
Contact dermatitis	2	["GCLC","GSS"]
Hereditary hemolytic anemia	2	["GCLC","GSS"]
Alzheimer disease	2	["GSS","EPC2"]