Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	388646
Gene name	Guanylate binding protein 7
Gene symbol	GBP7
Synonyms (NCBI Gene)	GBP4L
Chromosome	1
Chromosome location	1p22.2
Summary	Guanylate-binding proteins, such as GBP7, are induced by interferon and hydrolyze GTP to both GDP and GMP (Olszewski et al., 2006 [PubMed 16689661]).[supplied by OMIM, Dec 2008]

30 Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001818	Process	Negative regulation of cytokine production	IMP	33408175
GO:0002376	Process	Immune system process	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	ISS
GO:0005515	Function	Protein binding	IPI	28514442, 32296183, 33961781
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005525	Function	GTP binding	ISS
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IBA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031410	Component	Cytoplasmic vesicle	ISS
GO:0032480	Process	Negative regulation of type I interferon production	IMP	33408175
GO:0034345	Process	Negative regulation of type III interferon production	IMP	33408175
GO:0042742	Process	Defense response to bacterium	ISS
GO:0042832	Process	Defense response to protozoan	IBA
GO:0042832	Process	Defense response to protozoan	ISS
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	IMP	33408175
GO:0045070	Process	Positive regulation of viral genome replication	IMP	33408175
GO:0045087	Process	Innate immune response	IEA
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	IMP	33408175
GO:0050830	Process	Defense response to Gram-positive bacterium	IBA
GO:0051607	Process	Defense response to virus	IDA	33408175
GO:0051607	Process	Defense response to virus	IEA
GO:0051715	Process	Cytolysis in another organism	ISS
GO:0071346	Process	Cellular response to type II interferon	IBA

MIM	HGNC	e!Ensembl
612468	29606	ENSG00000213512

Q8N8V2

Protein name

Guanylate-binding protein 7 (EC 3.6.1.-) (EC 3.6.5.-) (GTP-binding protein 7) (GBP-7) (Guanine nucleotide-binding protein 7) (Guanylate-binding protein 4-like)

Protein function

Interferon (IFN)-inducible GTPase that plays important roles in innate immunity against a diverse range of bacterial, viral and protozoan pathogens (By similarity). Hydrolyzes GTP to GMP in two consecutive cleavage reactions and predominantly us

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02263	GBP	18 → 281	Guanylate-binding protein, N-terminal domain	Domain
PF02841	GBP_C	283 → 579	Guanylate-binding protein, C-terminal domain	Domain

Sequence

MASEIHMPGPVCLTENTKGHLVVNSEALEILSAITQPVVVVAIVGLYRTGKSYLMNKLAG
KNKGFPLGCTVKSETKGIWMWCVPHPSKPNHTLILLDTEGLGDMEKSDPKSDSWIFALAV
LLSSSFVYNSMGTINHQALEQLHYVTELTELIRAKSCPRPDEVEDSSEFVSFFPDFIWTV
RDFTLELKLDGHPITEDEYLENALKLISGKNPQIQNSNKPREWIRHFFPKQKCFVFDRPI
NDKKLLLHVEEVREDQLDSNFQMQSENFCSYIFTHAKTKTLREGILVTGNRLGMLVETYL
DAINSGATPCLENAMAVLAQCENSAAVQRAANHYSQQMAQQVRFPTDTLQELLDVHAVCE
REAIAVFMEYSFKDKSQEFQKKLVDTMEKKKEDFVLQNEEASAKYCQAELKRLSELLTES
ISRGTFFVPGGHNIYLEAKKKIEQDYTLVPRKGVKADEVLQSFLQSQVVIEESILQSDKA
LTAGEKAIAAKQAKKEAAEKEQELLRQKQKEQQQMMEAQERSFQENIAQLKKKMEREREN
YMRELRKMLSHKMKVLEELLTEGFKEIFESLNEEINRLKEQIEAAENEEPSVFSQILDVA
GSIFIAALPGAAKLVDLGMKILSSLCNRLRNPGKKIIS

Sequence length

638

Interactions

View interactions

KEGG Pathway	Reactome Pathway
NOD-like receptor signaling pathway	Interferon gamma signaling

GBP7 (guanylate binding protein 7)

Bookmark This Gene