GBP1 (guanylate binding protein 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 2633
• Gene name: Guanylate binding protein 1
• Gene symbol: GBP1
• Synonyms (NCBI Gene): hGBP1
• Chromosome: 1
• Chromosome location: 1p22.2
• Summary: Guanylate binding protein expression is induced by interferon. Guanylate binding proteins are characterized by their ability to specifically bind guanine nucleotides (GMP, GDP, and GTP) and are distinguished from the GTP-binding proteins by the presence o

miRNA Show/Hide all (71)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022397	hsa-miR-124-3p	Microarray	18668037
MIRT1013851	hsa-miR-4432	CLIP-seq
MIRT1013852	hsa-miR-4452	CLIP-seq
MIRT1013853	hsa-miR-4522	CLIP-seq
MIRT1013854	hsa-miR-4659a-3p	CLIP-seq
MIRT1013855	hsa-miR-4659b-3p	CLIP-seq
MIRT1013856	hsa-miR-4797-3p	CLIP-seq
MIRT1013857	hsa-miR-499-5p	CLIP-seq
MIRT1013858	hsa-miR-582-5p	CLIP-seq
MIRT1013859	hsa-miR-767-3p	CLIP-seq
MIRT1013860	hsa-miR-944	CLIP-seq
MIRT2388383	hsa-miR-3117-3p	CLIP-seq
MIRT2388384	hsa-miR-3124-3p	CLIP-seq
MIRT2388385	hsa-miR-3169	CLIP-seq
MIRT2388386	hsa-miR-3685	CLIP-seq
MIRT2388387	hsa-miR-377	CLIP-seq
MIRT2388388	hsa-miR-384	CLIP-seq
MIRT2388389	hsa-miR-4759	CLIP-seq
MIRT2388390	hsa-miR-5096	CLIP-seq
MIRT2537598	hsa-miR-30a	CLIP-seq
MIRT2537599	hsa-miR-30b	CLIP-seq
MIRT2537600	hsa-miR-30c	CLIP-seq
MIRT2537601	hsa-miR-30d	CLIP-seq
MIRT2537602	hsa-miR-30e	CLIP-seq
MIRT2388383	hsa-miR-3117-3p	CLIP-seq
MIRT2388384	hsa-miR-3124-3p	CLIP-seq
MIRT2388385	hsa-miR-3169	CLIP-seq
MIRT2537603	hsa-miR-335	CLIP-seq
MIRT2537604	hsa-miR-3617	CLIP-seq
MIRT2537605	hsa-miR-3618	CLIP-seq
MIRT2537606	hsa-miR-3646	CLIP-seq
MIRT2388386	hsa-miR-3685	CLIP-seq
MIRT2388387	hsa-miR-377	CLIP-seq
MIRT2388388	hsa-miR-384	CLIP-seq
MIRT2537607	hsa-miR-4257	CLIP-seq
MIRT2537608	hsa-miR-4275	CLIP-seq
MIRT2537609	hsa-miR-4282	CLIP-seq
MIRT2537610	hsa-miR-4477a	CLIP-seq
MIRT2537611	hsa-miR-4684-3p	CLIP-seq
MIRT2537612	hsa-miR-4731-3p	CLIP-seq
MIRT2388389	hsa-miR-4759	CLIP-seq
MIRT2537613	hsa-miR-4789-3p	CLIP-seq
MIRT2537614	hsa-miR-4797-5p	CLIP-seq
MIRT2537615	hsa-miR-4799-5p	CLIP-seq
MIRT2537616	hsa-miR-4801	CLIP-seq
MIRT2388390	hsa-miR-5096	CLIP-seq
MIRT1013858	hsa-miR-582-5p	CLIP-seq
MIRT2537617	hsa-miR-641	CLIP-seq
MIRT2537598	hsa-miR-30a	CLIP-seq
MIRT2537599	hsa-miR-30b	CLIP-seq
MIRT2537600	hsa-miR-30c	CLIP-seq
MIRT2537601	hsa-miR-30d	CLIP-seq
MIRT2537602	hsa-miR-30e	CLIP-seq
MIRT2388383	hsa-miR-3117-3p	CLIP-seq
MIRT2388384	hsa-miR-3124-3p	CLIP-seq
MIRT2388385	hsa-miR-3169	CLIP-seq
MIRT2537604	hsa-miR-3617	CLIP-seq
MIRT2537605	hsa-miR-3618	CLIP-seq
MIRT2388386	hsa-miR-3685	CLIP-seq
MIRT2388387	hsa-miR-377	CLIP-seq
MIRT2388388	hsa-miR-384	CLIP-seq
MIRT2537607	hsa-miR-4257	CLIP-seq
MIRT2537609	hsa-miR-4282	CLIP-seq
MIRT2537611	hsa-miR-4684-3p	CLIP-seq
MIRT2388389	hsa-miR-4759	CLIP-seq
MIRT2537613	hsa-miR-4789-3p	CLIP-seq
MIRT2537614	hsa-miR-4797-5p	CLIP-seq
MIRT2537615	hsa-miR-4799-5p	CLIP-seq
MIRT2388390	hsa-miR-5096	CLIP-seq
MIRT1013858	hsa-miR-582-5p	CLIP-seq
MIRT2537617	hsa-miR-641	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
YY1	Unknown	22162832

Gene ontology (GO) Show/Hide all (66)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0001530	Function	Lipopolysaccharide binding	IDA	32510692, 32581219
GO:0002376	Process	Immune system process	IEA
GO:0003779	Function	Actin binding	IDA	24337748
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IDA	7512561, 10676968, 16511497, 28645896, 29144452, 29233899, 31268602, 32510692, 32581219
GO:0003924	Function	GTPase activity	IEA
GO:0003925	Function	G protein activity	IDA	7512561, 16511497, 28645896, 29144452, 29233899
GO:0004382	Function	GDP phosphatase activity	IDA	7512561, 16511497, 28645896
GO:0004382	Function	GDP phosphatase activity	IEA
GO:0005515	Function	Protein binding	IPI	21151871, 24337748, 28514442, 33961781
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IDA	10676968, 10970849
GO:0005525	Function	GTP binding	IEA
GO:0005525	Function	GTP binding	TAS	1715024
GO:0005576	Component	Extracellular region	IEA
GO:0005737	Component	Cytoplasm	IDA	17266443, 21151871
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA	17266443
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IDA	24337748
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0012506	Component	Vesicle membrane	IDA	29144452, 29233899
GO:0012506	Component	Vesicle membrane	IDA	21151871, 31268602
GO:0015629	Component	Actin cytoskeleton	IDA	21151871
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019003	Function	GDP binding	IDA	10676968
GO:0019899	Function	Enzyme binding	IPI	24337748
GO:0019955	Function	Cytokine binding	IPI	24337748
GO:0030507	Function	Spectrin binding	IPI	24337748
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IBA
GO:0031410	Component	Cytoplasmic vesicle	IDA	29144452
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032703	Process	Negative regulation of interleukin-2 production	IMP	24337748
GO:0042742	Process	Defense response to bacterium	IDA	25119034
GO:0042742	Process	Defense response to bacterium	IDA	31268602, 32510692, 32581219
GO:0042742	Process	Defense response to bacterium	ISS
GO:0042802	Function	Identical protein binding	IPI	16511497, 21151871, 22059445, 22607347
GO:0042803	Function	Protein homodimerization activity	IDA	10676968, 21151871
GO:0042832	Process	Defense response to protozoan	IDA	31268602, 37797010
GO:0045087	Process	Innate immune response	IDA	29144452
GO:0045087	Process	Innate immune response	IEA
GO:0050848	Process	Regulation of calcium-mediated signaling	IMP	24337748
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IMP	24337748
GO:0051604	Process	Protein maturation	IDA	25119034
GO:0051607	Process	Defense response to virus	IEA
GO:0051715	Process	Cytolysis in another organism	IDA	31268602
GO:0051879	Function	Hsp90 protein binding	IPI	24337748
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IMP	24337748
GO:0071346	Process	Cellular response to type II interferon	IBA
GO:0071346	Process	Cellular response to type II interferon	IDA	17266443, 21151871
GO:0071347	Process	Cellular response to interleukin-1	IEP	17266443
GO:0071356	Process	Cellular response to tumor necrosis factor	IEP	17266443
GO:0072665	Process	Protein localization to vacuole	IDA	21151871
GO:0106139	Component	Symbiont cell surface	IDA	29144452, 29233899, 32510692, 32581219
GO:0140639	Process	Positive regulation of pyroptotic inflammatory response	IDA	31268602
GO:0160075	Process	Non-canonical inflammasome complex assembly	IDA	25119034, 26375003
GO:0160075	Process	Non-canonical inflammasome complex assembly	IDA	31268602, 32510692, 32581219
GO:1900025	Process	Negative regulation of substrate adhesion-dependent cell spreading	IMP	24337748
GO:1903076	Process	Regulation of protein localization to plasma membrane	IGI	24337748
GO:1903077	Process	Negative regulation of protein localization to plasma membrane	IMP	24337748

Other IDs

• MIM: 600411
• HGNC: 4182
• e!Ensembl: ENSG00000117228

Protein

• UniProt ID: P32455
• Protein name: Guanylate-binding protein 1 (EC 3.6.1.-) (EC 3.6.5.-) (GTP-binding protein 1) (GBP-1) (HuGBP-1) (hGBP1) (Guanine nucleotide-binding protein 1) (Interferon-induced guanylate-binding protein 1)
• Protein function: Interferon (IFN)-inducible GTPase that plays important roles in innate immunity against a diverse range of bacterial, viral and protozoan pathogens (PubMed:16511497, PubMed:22106366, PubMed:29144452, PubMed:31268602, PubMed:32510692, PubMed:3258
• PDB: 1DG3 , 1F5N , 2B8W , 2B92 , 2BC9 , 2D4H , 6K1Z , 6K2D , 6LOJ , 8CQB , 8Q4L , 8R1A
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02263	GBP	18 → 282	Guanylate-binding protein, N-terminal domain	Domain
  PF02841	GBP_C	284 → 580	Guanylate-binding protein, C-terminal domain	Domain

• Sequence:

  MASEIHMTGPMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAG
  KKKGFSLGSTVQSHTKGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAV
  LLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSPDENENEVEDSADFVSFFPDFVW
  TLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDR
  PVHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTLSGGIQVNGPRLESLVLTY
  VNAISSGDLPCMENAVLALAQIENSAAVQKAIAHYEQQMGQKVQLPTETLQELLDLHRDS
  EREAIEVFIRSSFKDVDHLFQKELAAQLEKKRDDFCKQNQEASSDRCSALLQVIFSPLEE
  EVKAGIYSKPGGYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTDQ
  TLTEKEKEIEVERVKAESAQASAKMLQEMQRKNEQMMEQKERSYQEHLKQLTEKMENDRV
  QLLKEQERTLALKLQEQEQLLKEGFQKESRIMKNEIQDLQTKMRRRKACTIS

• Sequence length: 592

Pathways

KEGG Pathway:

NOD-like receptor signaling pathway

Reactome Pathway:

Interferon gamma signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Neutrophil inclusion bodies	Likely pathogenic	rs66614512	RCV002292659	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Associations from Text Mining Show/Hide Text Mining Associations (67)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31421831		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27533247		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	36189314, 37573587	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	35570583	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29115931, 29350274		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23884293, 32265897, 38072995	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37551111	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	26965581	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26760981		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	36741232	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23042300, 26760981		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18697200		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32265897	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	29725478		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	32846838	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	35370940	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22162832, 26848767, 29991124		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22162832, 26848767, 29991124		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	18492260	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22162832, 26848767, 29991124		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	19079332	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	19079332, 23042300, 29051760		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	35653895	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35578687	Associate	★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	11598000, 28592529		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	33301214, 37052970	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	33123584	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33301214	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29115931, 29350274		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26760981		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19237608		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23042300, 23884293		★☆☆☆☆ Found in Text Mining only
McCune-Albright Syndrome	McCune-Albright Syndrome	BEFREE	15024646		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29725478		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	27605433	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	27605433		★☆☆☆☆ Found in Text Mining only
Microscopic Polyangiitis	Microscopic polyangiitis	Pubtator	23690996, 28569178	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	31600201	Stimulate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	34384424, 36510962	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	27010134	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	27010134		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22162832, 22964225, 23042300, 26848767, 29991124		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	35663470	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29348519		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	29348519	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	37796192	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26760981		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27590579, 27806724, 31991061, 32544083	Associate	★☆☆☆☆ Found in Text Mining only
Polyostotic fibrous dysplasia	Polyostotic Fibrous Dysplasia	BEFREE	15024646		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19237608		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	12414522	Stimulate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	38115636	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34168019	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	36187937	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	11598000	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	12414522	Stimulate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17822540		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	12414522	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26760981		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32269280, 36510962	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	21714544		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36519208	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	29115931	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29115931		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	38167153	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	11598000	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	11598000		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

GBP4 2 shared pathwaysNOD-like receptor signaling pathway, Interferon gamma signaling Related via 2 shared pathways including NOD-like receptor signaling pathway, Interferon gamma signaling. GBP5 2 shared pathwaysNOD-like receptor signaling pathway, Interferon gamma signaling Related via 2 shared pathways including NOD-like receptor signaling pathway, Interferon gamma signaling. GBP3 2 shared pathwaysNOD-like receptor signaling pathway, Interferon gamma signaling Related via 2 shared pathways including NOD-like receptor signaling pathway, Interferon gamma signaling. GBP7 2 shared pathwaysNOD-like receptor signaling pathway, Interferon gamma signaling Related via 2 shared pathways including NOD-like receptor signaling pathway, Interferon gamma signaling. GBP2 2 shared pathwaysNOD-like receptor signaling pathway, Interferon gamma signaling Related via 2 shared pathways including NOD-like receptor signaling pathway, Interferon gamma signaling.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
GBP4	0	[]	2	["NOD-like receptor signaling pathway","Interferon gamma signaling"]	0	[]
GBP5	0	[]	2	["NOD-like receptor signaling pathway","Interferon gamma signaling"]	0	[]
GBP3	0	[]	2	["NOD-like receptor signaling pathway","Interferon gamma signaling"]	0	[]
GBP7	0	[]	2	["NOD-like receptor signaling pathway","Interferon gamma signaling"]	0	[]
GBP2	0	[]	2	["NOD-like receptor signaling pathway","Interferon gamma signaling"]	0	[]

Diseases Linked via Similar Genes

Celiac disease Linked via 1 of 5 related genesGBP5 Neurodevelopmental disorder Linked via 1 of 5 related genesGBP5 Diabetes mellitus type 2 Linked via 1 of 5 related genesGBP5 Atherosclerosis Linked via 1 of 5 related genesGBP3 Myocardial ischemia Linked via 1 of 5 related genesGBP2

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Celiac disease	1	["GBP5"]
Neurodevelopmental disorder	1	["GBP5"]
Diabetes mellitus type 2	1	["GBP5"]
Atherosclerosis	1	["GBP3"]
Myocardial ischemia	1	["GBP2"]