GABRR2 (gamma-aminobutyric acid type A receptor subunit rho2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 2570
• Gene name: Gamma-aminobutyric acid type A receptor subunit rho2
• Gene symbol: GABRR2
• Synonyms (NCBI Gene): -
• Chromosome: 6
• Chromosome location: 6q15
• Summary: Gamma-aminobutyric acid (GABA) is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. The protein encoded by this gene is a member of the rho subunit family and is a compo

miRNA Show/Hide all (146)

miRTarBase ID	miRNA	Experiments	Reference
MIRT453919	hsa-miR-302f	PAR-CLIP	21572407
MIRT453918	hsa-miR-1910-3p	PAR-CLIP	21572407
MIRT453917	hsa-miR-6511a-5p	PAR-CLIP	21572407
MIRT453913	hsa-miR-4257	PAR-CLIP	21572407
MIRT453912	hsa-miR-4768-3p	PAR-CLIP	21572407
MIRT453911	hsa-miR-1247-3p	PAR-CLIP	21572407
MIRT453909	hsa-miR-219b-3p	PAR-CLIP	21572407
MIRT453908	hsa-miR-1827	PAR-CLIP	21572407
MIRT453907	hsa-miR-377-5p	PAR-CLIP	21572407
MIRT453906	hsa-miR-6086	PAR-CLIP	21572407
MIRT453905	hsa-miR-2467-3p	PAR-CLIP	21572407
MIRT453904	hsa-miR-4722-5p	PAR-CLIP	21572407
MIRT453903	hsa-miR-3612	PAR-CLIP	21572407
MIRT453902	hsa-miR-650	PAR-CLIP	21572407
MIRT453901	hsa-miR-4792	PAR-CLIP	21572407
MIRT453900	hsa-miR-4710	PAR-CLIP	21572407
MIRT453899	hsa-miR-6807-5p	PAR-CLIP	21572407
MIRT453898	hsa-miR-1273e	PAR-CLIP	21572407
MIRT453897	hsa-miR-7855-5p	PAR-CLIP	21572407
MIRT453919	hsa-miR-302f	PAR-CLIP	23592263
MIRT453918	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT453917	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT453916	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT453915	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT453914	hsa-miR-940	PAR-CLIP	23592263
MIRT453913	hsa-miR-4257	PAR-CLIP	23592263
MIRT453912	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT453911	hsa-miR-1247-3p	PAR-CLIP	23592263
MIRT453910	hsa-miR-4649-3p	PAR-CLIP	23592263
MIRT453909	hsa-miR-219b-3p	PAR-CLIP	23592263
MIRT453908	hsa-miR-1827	PAR-CLIP	23592263
MIRT453907	hsa-miR-377-5p	PAR-CLIP	23592263
MIRT453906	hsa-miR-6086	PAR-CLIP	23592263
MIRT453905	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT453904	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT453903	hsa-miR-3612	PAR-CLIP	23592263
MIRT453902	hsa-miR-650	PAR-CLIP	23592263
MIRT453901	hsa-miR-4792	PAR-CLIP	23592263
MIRT453900	hsa-miR-4710	PAR-CLIP	23592263
MIRT453899	hsa-miR-6807-5p	PAR-CLIP	23592263
MIRT453898	hsa-miR-1273e	PAR-CLIP	23592263
MIRT453897	hsa-miR-7855-5p	PAR-CLIP	23592263
MIRT453911	hsa-miR-1247-3p	PAR-CLIP	26701625
MIRT453911	hsa-miR-1247-3p	PAR-CLIP	26701625
MIRT453911	hsa-miR-1247-3p	PAR-CLIP	26701625
MIRT453898	hsa-miR-1273e	PAR-CLIP	26701625
MIRT453898	hsa-miR-1273e	PAR-CLIP	26701625
MIRT453898	hsa-miR-1273e	PAR-CLIP	26701625
MIRT453908	hsa-miR-1827	PAR-CLIP	26701625
MIRT453908	hsa-miR-1827	PAR-CLIP	26701625
MIRT453908	hsa-miR-1827	PAR-CLIP	26701625
MIRT453918	hsa-miR-1910-3p	PAR-CLIP	26701625
MIRT453918	hsa-miR-1910-3p	PAR-CLIP	26701625
MIRT453918	hsa-miR-1910-3p	PAR-CLIP	26701625
MIRT453909	hsa-miR-219b-3p	PAR-CLIP	26701625
MIRT453909	hsa-miR-219b-3p	PAR-CLIP	26701625
MIRT453909	hsa-miR-219b-3p	PAR-CLIP	26701625
MIRT453905	hsa-miR-2467-3p	PAR-CLIP	26701625
MIRT453905	hsa-miR-2467-3p	PAR-CLIP	26701625
MIRT453905	hsa-miR-2467-3p	PAR-CLIP	26701625
MIRT453919	hsa-miR-302f	PAR-CLIP	26701625
MIRT453919	hsa-miR-302f	PAR-CLIP	26701625
MIRT453919	hsa-miR-302f	PAR-CLIP	26701625
MIRT453903	hsa-miR-3612	PAR-CLIP	26701625
MIRT453907	hsa-miR-377-5p	PAR-CLIP	26701625
MIRT453907	hsa-miR-377-5p	PAR-CLIP	26701625
MIRT453907	hsa-miR-377-5p	PAR-CLIP	26701625
MIRT453913	hsa-miR-4257	PAR-CLIP	26701625
MIRT453913	hsa-miR-4257	PAR-CLIP	26701625
MIRT453913	hsa-miR-4257	PAR-CLIP	26701625
MIRT453900	hsa-miR-4710	PAR-CLIP	26701625
MIRT453900	hsa-miR-4710	PAR-CLIP	26701625
MIRT453900	hsa-miR-4710	PAR-CLIP	26701625
MIRT453904	hsa-miR-4722-5p	PAR-CLIP	26701625
MIRT453904	hsa-miR-4722-5p	PAR-CLIP	26701625
MIRT453904	hsa-miR-4722-5p	PAR-CLIP	26701625
MIRT453912	hsa-miR-4768-3p	PAR-CLIP	26701625
MIRT453912	hsa-miR-4768-3p	PAR-CLIP	26701625
MIRT453912	hsa-miR-4768-3p	PAR-CLIP	26701625
MIRT453901	hsa-miR-4792	PAR-CLIP	26701625
MIRT453901	hsa-miR-4792	PAR-CLIP	26701625
MIRT453901	hsa-miR-4792	PAR-CLIP	26701625
MIRT453906	hsa-miR-6086	PAR-CLIP	26701625
MIRT453906	hsa-miR-6086	PAR-CLIP	26701625
MIRT453906	hsa-miR-6086	PAR-CLIP	26701625
MIRT453902	hsa-miR-650	PAR-CLIP	26701625
MIRT453917	hsa-miR-6511a-5p	PAR-CLIP	26701625
MIRT453917	hsa-miR-6511a-5p	PAR-CLIP	26701625
MIRT453917	hsa-miR-6511a-5p	PAR-CLIP	26701625
MIRT453899	hsa-miR-6807-5p	PAR-CLIP	26701625
MIRT453899	hsa-miR-6807-5p	PAR-CLIP	26701625
MIRT453899	hsa-miR-6807-5p	PAR-CLIP	26701625
MIRT453916	hsa-miR-6808-5p	PAR-CLIP	26701625
MIRT453916	hsa-miR-6808-5p	PAR-CLIP	26701625
MIRT453916	hsa-miR-6808-5p	PAR-CLIP	26701625
MIRT453915	hsa-miR-6893-5p	PAR-CLIP	26701625
MIRT453915	hsa-miR-6893-5p	PAR-CLIP	26701625
MIRT453915	hsa-miR-6893-5p	PAR-CLIP	26701625
MIRT453897	hsa-miR-7855-5p	PAR-CLIP	26701625
MIRT453897	hsa-miR-7855-5p	PAR-CLIP	26701625
MIRT453897	hsa-miR-7855-5p	PAR-CLIP	26701625
MIRT453914	hsa-miR-940	PAR-CLIP	26701625
MIRT453914	hsa-miR-940	PAR-CLIP	26701625
MIRT453914	hsa-miR-940	PAR-CLIP	26701625
MIRT453919	hsa-miR-302f	PAR-CLIP	21572407
MIRT453918	hsa-miR-1910-3p	PAR-CLIP	21572407
MIRT453917	hsa-miR-6511a-5p	PAR-CLIP	21572407
MIRT453913	hsa-miR-4257	PAR-CLIP	21572407
MIRT453912	hsa-miR-4768-3p	PAR-CLIP	21572407
MIRT453911	hsa-miR-1247-3p	PAR-CLIP	21572407
MIRT453909	hsa-miR-219b-3p	PAR-CLIP	21572407
MIRT453908	hsa-miR-1827	PAR-CLIP	21572407
MIRT453907	hsa-miR-377-5p	PAR-CLIP	21572407
MIRT453906	hsa-miR-6086	PAR-CLIP	21572407
MIRT453905	hsa-miR-2467-3p	PAR-CLIP	21572407
MIRT453904	hsa-miR-4722-5p	PAR-CLIP	21572407
MIRT453903	hsa-miR-3612	PAR-CLIP	21572407
MIRT453902	hsa-miR-650	PAR-CLIP	21572407
MIRT453901	hsa-miR-4792	PAR-CLIP	21572407
MIRT453900	hsa-miR-4710	PAR-CLIP	21572407
MIRT453899	hsa-miR-6807-5p	PAR-CLIP	21572407
MIRT453898	hsa-miR-1273e	PAR-CLIP	21572407
MIRT453897	hsa-miR-7855-5p	PAR-CLIP	21572407
MIRT453919	hsa-miR-302f	PAR-CLIP	23592263
MIRT453918	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT453917	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT453916	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT453915	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT453914	hsa-miR-940	PAR-CLIP	23592263
MIRT453913	hsa-miR-4257	PAR-CLIP	23592263
MIRT453912	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT453911	hsa-miR-1247-3p	PAR-CLIP	23592263
MIRT453910	hsa-miR-4649-3p	PAR-CLIP	23592263
MIRT453909	hsa-miR-219b-3p	PAR-CLIP	23592263
MIRT453908	hsa-miR-1827	PAR-CLIP	23592263
MIRT453907	hsa-miR-377-5p	PAR-CLIP	23592263
MIRT453906	hsa-miR-6086	PAR-CLIP	23592263
MIRT453905	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT453904	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT453903	hsa-miR-3612	PAR-CLIP	23592263
MIRT453902	hsa-miR-650	PAR-CLIP	23592263
MIRT453901	hsa-miR-4792	PAR-CLIP	23592263
MIRT453900	hsa-miR-4710	PAR-CLIP	23592263
MIRT453899	hsa-miR-6807-5p	PAR-CLIP	23592263
MIRT453898	hsa-miR-1273e	PAR-CLIP	23592263
MIRT453897	hsa-miR-7855-5p	PAR-CLIP	23592263

Gene ontology (GO) Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004890	Function	GABA-A receptor activity	IBA
GO:0004890	Function	GABA-A receptor activity	IEA
GO:0004890	Function	GABA-A receptor activity	ISS
GO:0004890	Function	GABA-A receptor activity	TAS	1315307
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005230	Function	Extracellular ligand-gated monoatomic ion channel activity	IEA
GO:0005254	Function	Chloride channel activity	IBA
GO:0005254	Function	Chloride channel activity	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	1315307
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006821	Process	Chloride transport	IEA
GO:0007165	Process	Signal transduction	TAS	1315307
GO:0007214	Process	Gamma-aminobutyric acid signaling pathway	IEA
GO:0007268	Process	Chemical synaptic transmission	TAS	1315307
GO:0007601	Process	Visual perception	IEA
GO:0016020	Component	Membrane	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0022851	Function	GABA-gated chloride ion channel activity	IEA
GO:0022851	Function	GABA-gated chloride ion channel activity	ISS
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034707	Component	Chloride channel complex	IEA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0051932	Process	Synaptic transmission, GABAergic	IBA
GO:0060078	Process	Regulation of postsynaptic membrane potential	IEA
GO:0097708	Component	Intracellular vesicle	IEA
GO:0098982	Component	GABA-ergic synapse	IEA
GO:1902476	Process	Chloride transmembrane transport	IBA
GO:1902711	Component	GABA-A receptor complex	IBA
GO:1904315	Function	Transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential	IEA

Other IDs

• MIM: 137162
• HGNC: 4091
• e!Ensembl: ENSG00000111886

Protein

• UniProt ID: P28476
• Protein name: Gamma-aminobutyric acid receptor subunit rho-2 (GABA(A) receptor subunit rho-2) (GABAAR subunit rho-2) (GABA(C) receptor)
• Protein function: Rho subunit of the pentameric ligand-gated chloride channels responsible for mediating the effects of gamma-aminobutyric acid (GABA), the major inhibitory neurotransmitter in the brain (By similarity). Rho-containing GABA-gated chloride channels
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02931	Neur_chan_LBD	55 → 261	Neurotransmitter-gated ion-channel ligand binding domain	Family
  PF02932	Neur_chan_memb	268 → 409	Neurotransmitter-gated ion-channel transmembrane region	Family

• Sequence:

  MPYFTRLILFLFCLMVLVESRKPKRKRWTGQVEMPKPSHLYKKNLDVTKIRKGKPQQLLR
  VDEHDFSMRPAFGGPAIPVGVDVQVESLDSISEVDMDFTMTLYLRHYWKDERLAFSSASN
  KSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLYSMRITVTAMCNM
  DFSHFPLDSQTCSLELESYAYTDEDLMLYWKNGDESLKTDEKISLSQFLIQKFHTTSRLA
  FYSSTGWYNRLYINFTLRRHIFFFLLQTYFPATLMVMLSWVSFWIDRRAVPARVSLGITT
  VLTMTTIITGVNASMPRVSYVKAVDIYLWVSFVFVFLSVLEYAAVNYLTTVQERKERKLR
  EKFPCMCGMLHSKTMMLDGSYSESEANSLAGYPRSHILTEEERQDKIVVHLGLSGEANAA
  RKKGLLKGQTGFRIFQNTHAIDKYSRLIFPASYIFFNLIYWSVFS

• Sequence length: 465

Pathways

KEGG Pathway	Reactome Pathway
Neuroactive ligand-receptor interaction	GABA receptor activation
Retrograde endocannabinoid signaling
GABAergic synapse
Morphine addiction
Nicotine addiction

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (7)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
AUTISTIC DISORDER	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	GWAS catalog	29703844	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	CTD, Disgenet CTD, Disgenet	19784758	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	35330412	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Progressive sensorineural hearing impairment	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	32771030	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (8)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Autistic Disorder	Autism	Pubtator	16080114	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	20889312		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognition Disorders	Cognition disorder	Pubtator	26922432	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	21420396		★☆☆☆☆ Found in Text Mining only
Essential Tremor	Tremor	BEFREE	20820800		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	28699326		★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Restless Legs Syndrome	BEFREE	29720720		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	9585594	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

GABRR1 1 shared diseaseDiabetic neuropathy 5 shared pathwaysRetrograde endocannabinoid signaling, GABAergic synapse, Morphine addiction, Nicotine addiction, GABA receptor activation 1 shared evidence sourceGWAS catalog (Diabetic neuropathy) Related via 5 shared pathways including Retrograde endocannabinoid signaling, GABAergic synapse — evidence mostly GWAS catalog. HK3 1 shared diseaseLiver disease 2 shared evidence sourcesDisgenet (Liver disease), CTD (Liver disease) Related via 1 shared disease including Liver disease — evidence mostly Disgenet. RNASE6 1 shared diseaseLiver disease 2 shared evidence sourcesDisgenet (Liver disease), CTD (Liver disease) Related via 1 shared disease including Liver disease — evidence mostly Disgenet. SRSF5 1 shared diseaseLiver disease 2 shared evidence sourcesDisgenet (Liver disease), CTD (Liver disease) Related via 1 shared disease including Liver disease — evidence mostly Disgenet. GABRR3 5 shared pathwaysRetrograde endocannabinoid signaling, GABAergic synapse, Morphine addiction, Nicotine addiction, GABA receptor activation Related via 5 shared pathways including Retrograde endocannabinoid signaling, GABAergic synapse.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
GABRR1	1	["Diabetic neuropathy"]	5	["Retrograde endocannabinoid signaling","GABAergic synapse","Morphine addiction","Nicotine addiction","GABA receptor activation"]	1	["GWAS catalog (Diabetic neuropathy)"]
HK3	1	["Liver disease"]	0	[]	2	["Disgenet (Liver disease)","CTD (Liver disease)"]
RNASE6	1	["Liver disease"]	0	[]	2	["Disgenet (Liver disease)","CTD (Liver disease)"]
SRSF5	1	["Liver disease"]	0	[]	2	["Disgenet (Liver disease)","CTD (Liver disease)"]
GABRR3	0	[]	5	["Retrograde endocannabinoid signaling","GABAergic synapse","Morphine addiction","Nicotine addiction","GABA receptor activation"]	0	[]

Diseases Linked via Similar Genes

Schizophrenia Linked via 1 of 5 related genesGABRR1 Uterine fibroid Linked via 1 of 5 related genesHK3

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Schizophrenia	1	["GABRR1"]
Uterine fibroid	1	["HK3"]