FOXO6 (forkhead box O6)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 100132074
• Gene name: Forkhead box O6
• Gene symbol: FOXO6
• Synonyms (NCBI Gene): -
• Chromosome: 1
• Chromosome location: 1p34.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT455823	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT455823	hsa-miR-6840-3p	PAR-CLIP	23592263

Gene ontology (GO) Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISS
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	23714368
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	ISS
GO:0007613	Process	Memory	IEA
GO:0008013	Function	Beta-catenin binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0060999	Process	Positive regulation of dendritic spine development	IEA
GO:0060999	Process	Positive regulation of dendritic spine development	ISS

Other IDs

• MIM: 611457
• HGNC: 24814
• e!Ensembl: ENSG00000204060

Protein

• UniProt ID: A8MYZ6
• Protein name: Forkhead box protein O6
• Protein function: Transcriptional activator.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00250	Forkhead	88 → 175	Forkhead domain	Domain
  PF16676	FOXO-TAD	430 → 471	Transactivation domain of FOXO protein family	Domain

• Sequence:

  MAAKLRAHQVDVDPDFAPQSRPRSCTWPLPQPDLAGDEDGALGAGVAEGAEDCGPERRAT
  APAMAPAPPLGAEVGPLRKAKSSRRNAWGNLSYADLITKAIESAPDKRLTLSQIYDWMVR
  YVPYFKDKGDSNSSAGWKNSIRHNLSLHTRFIRVQNEGTGKSSWWMLNPEGGKTGKTPRR
  RAVSMDNGAKFLRIKGKASKKKQLQAPERSPDDSSPSAPAPGPVPAAAKWAASPASHASD
  DYEAWADFRGGGRPLLGEAAELEDDEALEALAPSSPLMYPSPASALSPALGSRCPGELPR
  LAELGGPLGLHGGGGAGLPEGLLDGAQDAYGPRPAPRPGPVLGAPGELALAGAAAAYPGK
  GAAPYAPPAPSRSALAHPISLMTLPGEAGAAGLAPPGHAAAFGGPPGGLLLDALPGPYAA
  AAAGPLGAAPDRFPADLDLDMFSGSLECDVESIILNDFMDSDEMDFNFDSALPPPPPGLA
  GAPPPNQSWVPG

• Sequence length: 492

Pathways

KEGG Pathway

FoxO signaling pathway

Shigellosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (11)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ANDROGENETIC ALOPECIA	—	GWAS catalog	30573740	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	35764056	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	35764056	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	36496446, 38182794	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	21926972	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	35915156	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASOPHARYNGEAL NEOPLASM	—	GWAS catalog	24376627	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR HYPOTENSION	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	26198764, 31374203, 35396580	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (30)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Axenfeld-Rieger syndrome	Axenfeld anomaly	BEFREE	30286078		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	28234206	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	30464613		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34197655	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27227932, 31894125	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25695151		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30321450		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	21940782, 28213398, 30548643		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	21940782, 28213398, 30548643		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	24437489, 28213398		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	30548643		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	21940782, 28213398		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	28213398		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	31894125	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25686219	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28404958	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30464613		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25695151		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28404958		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28774834		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	34507637	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30306263, 30464613		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	21940782, 24437489, 28213398		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	28234206, 30082721	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	30082721		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	31374203		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28404958		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23714368	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28404958, 31894125	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29588373		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

BNIP3 2 shared pathwaysFoxO signaling pathway, Shigellosis Related via 2 shared pathways including FoxO signaling pathway, Shigellosis. ATG12 2 shared pathwaysFoxO signaling pathway, Shigellosis Related via 2 shared pathways including FoxO signaling pathway, Shigellosis. FOXO4 2 shared pathwaysFoxO signaling pathway, Shigellosis Related via 2 shared pathways including FoxO signaling pathway, Shigellosis. CLPTM1L 1 shared diseaseNasopharyngeal neoplasms 2 shared evidence sourcesGWAS catalog (Basal cell carcinoma), GWAS catalog (Nasopharyngeal neoplasms) Related via 1 shared disease including Nasopharyngeal neoplasms — evidence mostly GWAS catalog. FOXO1 2 shared pathwaysFoxO signaling pathway, Shigellosis Related via 2 shared pathways including FoxO signaling pathway, Shigellosis.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
BNIP3	0	[]	2	["FoxO signaling pathway","Shigellosis"]	0	[]
ATG12	0	[]	2	["FoxO signaling pathway","Shigellosis"]	0	[]
FOXO4	0	[]	2	["FoxO signaling pathway","Shigellosis"]	0	[]
CLPTM1L	1	["Nasopharyngeal neoplasms"]	0	[]	2	["GWAS catalog (Basal cell carcinoma)","GWAS catalog (Nasopharyngeal neoplasms)"]
FOXO1	0	[]	2	["FoxO signaling pathway","Shigellosis"]	0	[]

Diseases Linked via Similar Genes

Prostatic neoplasms Linked via 3 of 5 related genesBNIP3, CLPTM1L, FOXO1 Alzheimer disease Linked via 2 of 5 related genesBNIP3, FOXO1 Colorectal cancer Linked via 2 of 5 related genesATG12, CLPTM1L Uterine fibroid Linked via 2 of 5 related genesCLPTM1L, FOXO1 Multiple myeloma Linked via 1 of 5 related genesBNIP3

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Prostatic neoplasms	3	["BNIP3","CLPTM1L","FOXO1"]
Alzheimer disease	2	["BNIP3","FOXO1"]
Colorectal cancer	2	["ATG12","CLPTM1L"]
Uterine fibroid	2	["CLPTM1L","FOXO1"]
Multiple myeloma	1	["BNIP3"]