FOXO1 (forkhead box O1)

Gene

• Entrez ID: 2308
• Gene name: Forkhead box O1
• Gene symbol: FOXO1
• Synonyms (NCBI Gene): FKH1, FKHR, FOXO1A
• Chromosome: 13
• Chromosome location: 13q14.11
• Summary: This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. T

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001088	hsa-miR-27a-3p	qRT-PCR, Luciferase reporter assay, Western blot	19574223
MIRT001087	hsa-miR-96-5p	qRT-PCR, Luciferase reporter assay, Western blot	19574223
MIRT001086	hsa-miR-182-5p	qRT-PCR, Luciferase reporter assay, Western blot	19574223
MIRT001086	hsa-miR-182-5p	Luciferase reporter assay	19574223
MIRT001088	hsa-miR-27a-3p	Luciferase reporter assay	19574223
MIRT001087	hsa-miR-96-5p	Luciferase reporter assay	19574223
MIRT003300	hsa-miR-9-5p	Immunohistochemistry, Northern blot, qRT-PCR, Western blot	20028871
MIRT001088	hsa-miR-27a-3p	Immunohistochemistry, Northern blot, qRT-PCR, Western blot	20028871
MIRT001087	hsa-miR-96-5p	Immunohistochemistry, Northern blot, qRT-PCR, Western blot	20028871
MIRT003299	hsa-miR-153-3p	Immunohistochemistry, Northern blot, qRT-PCR, Western blot	20028871
MIRT003298	hsa-miR-183-5p	Immunohistochemistry, Northern blot, qRT-PCR, Western blot	20028871
MIRT003297	hsa-miR-186-5p	Immunohistochemistry, Northern blot, qRT-PCR, Western blot	20028871
MIRT003297	hsa-miR-186-5p	Immunohistochemistry, Northern blot, qRT-PCR, Western blot	20028871
MIRT001088	hsa-miR-27a-3p	Immunohistochemistry, qRT-PCR, Western blot	22213032
MIRT006733	hsa-miR-223-3p	Flow, Immunocytochemistry, Luciferase reporter assay, qRT-PCR, Western blot	22569260
MIRT006733	hsa-miR-223-3p	Flow, Immunocytochemistry, Luciferase reporter assay, qRT-PCR, Western blot	22569260
MIRT003300	hsa-miR-9-5p	Luciferase reporter assay	23509296
MIRT016933	hsa-miR-335-5p	Microarray	18185580
MIRT027447	hsa-miR-98-5p	Microarray	19088304
MIRT051345	hsa-miR-15a-5p	CLASH	23622248
MIRT048219	hsa-miR-196a-5p	CLASH	23622248
MIRT045840	hsa-miR-132-3p	CLASH	23622248
MIRT038575	hsa-miR-106b-3p	CLASH	23622248
MIRT051345	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24862853
MIRT051345	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24862853
MIRT052909	hsa-miR-15b-5p	Luciferase reporter assay, qRT-PCR, Western blot	24862853
MIRT052909	hsa-miR-15b-5p	Luciferase reporter assay, qRT-PCR, Western blot	24862853
MIRT053058	hsa-miR-370-3p	Luciferase reporter assay, qRT-PCR, Western blot	23721824
MIRT001087	hsa-miR-96-5p	Microarray	23807165
MIRT053058	hsa-miR-370-3p	Luciferase reporter assay, qRT-PCR, Western blot	23721824
MIRT053058	hsa-miR-370-3p	Luciferase reporter assay, qRT-PCR, Western blot	23721824
MIRT053590	hsa-miR-107	Luciferase reporter assay, qRT-PCR, Western blot	24374340
MIRT053058	hsa-miR-370-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	23029264
MIRT054366	hsa-miR-132-5p	In situ hybridization, Luciferase reporter assay, Next Generation Sequencing (NGS), Western blot	24014289
MIRT001086	hsa-miR-182-5p	Immunohistochemistry, Microarray, qRT-PCR	24865442
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24423924
MIRT001088	hsa-miR-27a-3p	Immunohistochemistry, In situ hybridization, Microarray, qRT-PCR	24746199
MIRT438508	hsa-miR-27b-3p	Immunohistochemistry, In situ hybridization, Microarray, qRT-PCR	24746199
MIRT006733	hsa-miR-223-3p	Luciferase reporter assay	24324762
MIRT003298	hsa-miR-183-5p	Luciferase reporter assay, qRT-PCR, Western blot	24368418
MIRT003298	hsa-miR-183-5p	Luciferase reporter assay, qRT-PCR, Western blot	24368418
MIRT001088	hsa-miR-27a-3p	Immunohistochemistry, In situ hybridization, Microarray, qRT-PCR	24746199
MIRT438508	hsa-miR-27b-3p	Immunohistochemistry, In situ hybridization, Microarray, qRT-PCR	24746199
MIRT006733	hsa-miR-223-3p	Luciferase reporter assay	24324762
MIRT003298	hsa-miR-183-5p	Luciferase reporter assay, qRT-PCR, Western blot	24368418
MIRT003298	hsa-miR-183-5p	Luciferase reporter assay, qRT-PCR, Western blot	24368418
MIRT658095	hsa-miR-4282	HITS-CLIP	23824327
MIRT658094	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT658093	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT658092	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT658091	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT557817	hsa-miR-562	PAR-CLIP	20371350
MIRT557813	hsa-miR-4733-5p	PAR-CLIP	20371350
MIRT557811	hsa-miR-520g-3p	PAR-CLIP	20371350
MIRT557810	hsa-miR-520h	PAR-CLIP	20371350
MIRT557809	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT557808	hsa-miR-324-5p	PAR-CLIP	20371350
MIRT557807	hsa-miR-3177-5p	PAR-CLIP	20371350
MIRT068628	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT557817	hsa-miR-562	PAR-CLIP	21572407
MIRT557816	hsa-miR-499a-3p	PAR-CLIP	21572407
MIRT557815	hsa-miR-499b-3p	PAR-CLIP	21572407
MIRT557814	hsa-miR-34c-3p	PAR-CLIP	21572407
MIRT557813	hsa-miR-4733-5p	PAR-CLIP	21572407
MIRT557812	hsa-miR-6715a-3p	PAR-CLIP	21572407
MIRT557811	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT557810	hsa-miR-520h	PAR-CLIP	21572407
MIRT557809	hsa-miR-186-3p	PAR-CLIP	21572407
MIRT557808	hsa-miR-324-5p	PAR-CLIP	21572407
MIRT557807	hsa-miR-3177-5p	PAR-CLIP	21572407
MIRT068628	hsa-let-7c-3p	PAR-CLIP	21572407
MIRT537320	hsa-miR-941	PAR-CLIP	22012620
MIRT537318	hsa-miR-5000-5p	PAR-CLIP	22012620
MIRT537317	hsa-miR-935	PAR-CLIP	22012620
MIRT537316	hsa-miR-593-5p	PAR-CLIP	22012620
MIRT003298	hsa-miR-183-5p	PAR-CLIP	22012620
MIRT001086	hsa-miR-182-5p	PAR-CLIP	22012620
MIRT537315	hsa-miR-1271-5p	PAR-CLIP	22012620
MIRT001087	hsa-miR-96-5p	PAR-CLIP	22012620
MIRT445379	hsa-miR-8087	PAR-CLIP	22100165
MIRT445380	hsa-miR-3925-5p	PAR-CLIP	22100165
MIRT445378	hsa-miR-3123	PAR-CLIP	22100165
MIRT445377	hsa-miR-520g-5p	PAR-CLIP	22100165
MIRT445376	hsa-miR-517-5p	PAR-CLIP	22100165
MIRT445375	hsa-miR-1251-5p	PAR-CLIP	22100165
MIRT445374	hsa-miR-1253	PAR-CLIP	22100165
MIRT445373	hsa-miR-518d-5p	PAR-CLIP	22100165
MIRT445372	hsa-miR-518e-5p	PAR-CLIP	22100165
MIRT445371	hsa-miR-518f-5p	PAR-CLIP	22100165
MIRT445370	hsa-miR-519a-5p	PAR-CLIP	22100165
MIRT445369	hsa-miR-519b-5p	PAR-CLIP	22100165
MIRT445368	hsa-miR-519c-5p	PAR-CLIP	22100165
MIRT445367	hsa-miR-520c-5p	PAR-CLIP	22100165
MIRT445366	hsa-miR-522-5p	PAR-CLIP	22100165
MIRT445365	hsa-miR-523-5p	PAR-CLIP	22100165
MIRT445364	hsa-miR-526a	PAR-CLIP	22100165
MIRT445379	hsa-miR-8087	PAR-CLIP	22100165
MIRT445380	hsa-miR-3925-5p	PAR-CLIP	22100165
MIRT445378	hsa-miR-3123	PAR-CLIP	22100165
MIRT445377	hsa-miR-520g-5p	PAR-CLIP	22100165
MIRT445376	hsa-miR-517-5p	PAR-CLIP	22100165
MIRT445375	hsa-miR-1251-5p	PAR-CLIP	22100165
MIRT445374	hsa-miR-1253	PAR-CLIP	22100165
MIRT445373	hsa-miR-518d-5p	PAR-CLIP	22100165
MIRT445372	hsa-miR-518e-5p	PAR-CLIP	22100165
MIRT445371	hsa-miR-518f-5p	PAR-CLIP	22100165
MIRT445370	hsa-miR-519a-5p	PAR-CLIP	22100165
MIRT445369	hsa-miR-519b-5p	PAR-CLIP	22100165
MIRT445368	hsa-miR-519c-5p	PAR-CLIP	22100165
MIRT445367	hsa-miR-520c-5p	PAR-CLIP	22100165
MIRT445366	hsa-miR-522-5p	PAR-CLIP	22100165
MIRT445365	hsa-miR-523-5p	PAR-CLIP	22100165
MIRT445364	hsa-miR-526a	PAR-CLIP	22100165
MIRT440614	hsa-miR-376a-3p	HITS-CLIP	24374217
MIRT440614	hsa-miR-376a-3p	HITS-CLIP	24374217
MIRT731353	hsa-miR-9-3p	Luciferase reporter assay, Western blot	28397066
MIRT731353	hsa-miR-9-3p	Luciferase reporter assay, Western blot	28397066
MIRT045840	hsa-miR-132-3p	Luciferase reporter assay, qRT-PCR, Western blot	26298723
MIRT045840	hsa-miR-132-3p	Luciferase reporter assay, qRT-PCR, Western blot	26298723
MIRT001087	hsa-miR-96-5p	Luciferase reporter assay, qRT-PCR, Western blot	26617698
MIRT001087	hsa-miR-96-5p	Luciferase reporter assay, qRT-PCR, Western blot	26617698
MIRT001087	hsa-miR-96-5p	Luciferase reporter assay, qRT-PCR, Western blot	26617698
MIRT001087	hsa-miR-96-5p	Luciferase reporter assay, qRT-PCR, Western blot	26617698
MIRT438508	hsa-miR-27b-3p	qRT-PCR, Western blot	26452502
MIRT732296	hsa-miR-135b-5p	Flow, Luciferase reporter assay, Western blot	26617737
MIRT732296	hsa-miR-135b-5p	Flow, Luciferase reporter assay, Western blot	26617737
MIRT001087	hsa-miR-96-5p	Luciferase reporter assay, qRT-PCR, Western blot	25369914
MIRT001087	hsa-miR-96-5p	Luciferase reporter assay, qRT-PCR, Western blot	25369914
MIRT003300	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blot	26593208
MIRT003300	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blot	26593208
MIRT003300	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blot	26593208
MIRT003300	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blot	26593208
MIRT734005	hsa-miR-486-5p	Luciferase reporter assay, Western blot	25515961
MIRT734005	hsa-miR-486-5p	Luciferase reporter assay, Western blot	25515961
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, Western blot	27108614
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, Western blot	27108614
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, Western blot	27108614
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, Western blot	27108614
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, Western blot	27108614
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, Western blot	27108614
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, Western blot	27108614
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, Western blot	27108614
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, Western blot	27108614
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, Western blot	27108614
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, Western blot	27108614
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, Western blot	27108614
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, Western blot	27108614
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, Western blot	27108614
MIRT045840	hsa-miR-132-3p	Luciferase reporter assay, Western blot	27556448
MIRT045840	hsa-miR-132-3p	Luciferase reporter assay, Western blot	27556448
MIRT048219	hsa-miR-196a-5p	NCI-H460"	27880728
MIRT756306	hsa-miR-21-5p	Luciferase reporter assay, qRT-PCR, Western blot	25909227
MIRT052909	hsa-miR-15b-5p	Flow cytometry, Luciferase reporter assay, Microarray, qRT-PCR, Western blotting	33519190
MIRT052909	hsa-miR-15b-5p	Flow cytometry, Luciferase reporter assay, Microarray, qRT-PCR, Western blotting	33519190
MIRT732296	hsa-miR-135b-5p	Immunohistochemistry (IHC), Luciferase reporter assay, qRT-PCR, Western blotting	31416776
MIRT733821	hsa-miR-34a-3p	qRT-PCR	33718673
MIRT734005	hsa-miR-486-5p	Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	32094299
MIRT735024	hsa-miR-374a-5p	Luciferase reporter assay, Western blotting, qRT-PCR, ELISA	33296140
MIRT735089	hsa-miR-5188	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR	31695788
MIRT438508	hsa-miR-27b-3p	Luciferase reporter assay, qRT-PCR	31526292
MIRT438508	hsa-miR-27b-3p	Luciferase reporter assay, qRT-PCR	31526292
MIRT736342	hsa-miR-28-5p	Luciferase reporter assay, Western blotting, qRT-PCR	31934134
MIRT736354	hsa-miR-139-5p	Western blotting, qRT-PCR, Flow cytometry	34249000
MIRT003298	hsa-miR-183-5p	Luciferase reporter assay, qRT-PCR	34036107
MIRT736962	hsa-miR-3127-5p	CLIP-seq, qRT-PCR	32221048
MIRT737137	hsa-miR-15b-3p	Luciferase reporter assay, Western blotting, Microarray, Immunoprecipitaion (IP), qRT-PCR, Flow cytometry	33519190
MIRT658095	hsa-miR-4282	HITS-CLIP	23824327
MIRT658094	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT658093	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT658092	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT658091	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT557817	hsa-miR-562	PAR-CLIP	20371350
MIRT557813	hsa-miR-4733-5p	PAR-CLIP	20371350
MIRT557811	hsa-miR-520g-3p	PAR-CLIP	20371350
MIRT557810	hsa-miR-520h	PAR-CLIP	20371350
MIRT557809	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT557808	hsa-miR-324-5p	PAR-CLIP	20371350
MIRT557807	hsa-miR-3177-5p	PAR-CLIP	20371350
MIRT068628	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT557817	hsa-miR-562	PAR-CLIP	21572407
MIRT557816	hsa-miR-499a-3p	PAR-CLIP	21572407
MIRT557815	hsa-miR-499b-3p	PAR-CLIP	21572407
MIRT557814	hsa-miR-34c-3p	PAR-CLIP	21572407
MIRT557813	hsa-miR-4733-5p	PAR-CLIP	21572407
MIRT557812	hsa-miR-6715a-3p	PAR-CLIP	21572407
MIRT557811	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT557810	hsa-miR-520h	PAR-CLIP	21572407
MIRT557809	hsa-miR-186-3p	PAR-CLIP	21572407
MIRT557808	hsa-miR-324-5p	PAR-CLIP	21572407
MIRT557807	hsa-miR-3177-5p	PAR-CLIP	21572407
MIRT068628	hsa-let-7c-3p	PAR-CLIP	21572407
MIRT537320	hsa-miR-941	PAR-CLIP	22012620
MIRT537318	hsa-miR-5000-5p	PAR-CLIP	22012620
MIRT537317	hsa-miR-935	PAR-CLIP	22012620
MIRT537316	hsa-miR-593-5p	PAR-CLIP	22012620
MIRT003298	hsa-miR-183-5p	PAR-CLIP	22012620
MIRT001086	hsa-miR-182-5p	PAR-CLIP	22012620
MIRT537315	hsa-miR-1271-5p	PAR-CLIP	22012620
MIRT001087	hsa-miR-96-5p	PAR-CLIP	22012620
MIRT445379	hsa-miR-8087	PAR-CLIP	22100165
MIRT445380	hsa-miR-3925-5p	PAR-CLIP	22100165
MIRT445378	hsa-miR-3123	PAR-CLIP	22100165
MIRT445377	hsa-miR-520g-5p	PAR-CLIP	22100165
MIRT445376	hsa-miR-517-5p	PAR-CLIP	22100165
MIRT445375	hsa-miR-1251-5p	PAR-CLIP	22100165
MIRT445374	hsa-miR-1253	PAR-CLIP	22100165
MIRT445373	hsa-miR-518d-5p	PAR-CLIP	22100165
MIRT445372	hsa-miR-518e-5p	PAR-CLIP	22100165
MIRT445371	hsa-miR-518f-5p	PAR-CLIP	22100165
MIRT445370	hsa-miR-519a-5p	PAR-CLIP	22100165
MIRT445369	hsa-miR-519b-5p	PAR-CLIP	22100165
MIRT445368	hsa-miR-519c-5p	PAR-CLIP	22100165
MIRT445367	hsa-miR-520c-5p	PAR-CLIP	22100165
MIRT445366	hsa-miR-522-5p	PAR-CLIP	22100165
MIRT445365	hsa-miR-523-5p	PAR-CLIP	22100165
MIRT445364	hsa-miR-526a	PAR-CLIP	22100165
MIRT445379	hsa-miR-8087	PAR-CLIP	22100165
MIRT445380	hsa-miR-3925-5p	PAR-CLIP	22100165
MIRT445378	hsa-miR-3123	PAR-CLIP	22100165
MIRT445377	hsa-miR-520g-5p	PAR-CLIP	22100165
MIRT445376	hsa-miR-517-5p	PAR-CLIP	22100165
MIRT445375	hsa-miR-1251-5p	PAR-CLIP	22100165
MIRT445374	hsa-miR-1253	PAR-CLIP	22100165
MIRT445373	hsa-miR-518d-5p	PAR-CLIP	22100165
MIRT445372	hsa-miR-518e-5p	PAR-CLIP	22100165
MIRT445371	hsa-miR-518f-5p	PAR-CLIP	22100165
MIRT445370	hsa-miR-519a-5p	PAR-CLIP	22100165
MIRT445369	hsa-miR-519b-5p	PAR-CLIP	22100165
MIRT445368	hsa-miR-519c-5p	PAR-CLIP	22100165
MIRT445367	hsa-miR-520c-5p	PAR-CLIP	22100165
MIRT445366	hsa-miR-522-5p	PAR-CLIP	22100165
MIRT445365	hsa-miR-523-5p	PAR-CLIP	22100165
MIRT445364	hsa-miR-526a	PAR-CLIP	22100165
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, Western blotting, qRT-PCR, in vitro cullelar assays, in vivo gain/loss-of-function experiments	35634243
MIRT755765	hsa-miR-144-3p	Luciferase reporter assay, Western blotting, Flow cytometry	37272921
MIRT001086	hsa-miR-182-5p	Luciferase reporter assay, Western blotting, qRT-PCR	34950682
MIRT755765	hsa-miR-144-3p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunofluorescence	38165707
MIRT003298	hsa-miR-183-5p	Luciferase reporter assay, Western blotting, qRT-PCR	34867446
MIRT756306	hsa-miR-21-5p	qRT-PCR	36071352
MIRT537315	hsa-miR-1271-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunofluorescence, ChIP-seq, Flow cytometry	36298739
MIRT1002862	hsa-miR-1224-3p	CLIP-seq
MIRT1002863	hsa-miR-1251	CLIP-seq
MIRT1002864	hsa-miR-1256	CLIP-seq
MIRT1002865	hsa-miR-1470	CLIP-seq
MIRT1002866	hsa-miR-320a	CLIP-seq
MIRT1002867	hsa-miR-320b	CLIP-seq
MIRT1002868	hsa-miR-320c	CLIP-seq
MIRT1002869	hsa-miR-320d	CLIP-seq
MIRT1002870	hsa-miR-320e	CLIP-seq
MIRT1002871	hsa-miR-365	CLIP-seq
MIRT1002872	hsa-miR-3667-3p	CLIP-seq
MIRT1002873	hsa-miR-371b-5p	CLIP-seq
MIRT1002874	hsa-miR-3938	CLIP-seq
MIRT1002875	hsa-miR-4257	CLIP-seq
MIRT1002876	hsa-miR-4428	CLIP-seq
MIRT1002877	hsa-miR-4429	CLIP-seq
MIRT1002878	hsa-miR-4436b-5p	CLIP-seq
MIRT1002879	hsa-miR-4527	CLIP-seq
MIRT1002880	hsa-miR-4639-5p	CLIP-seq
MIRT1002881	hsa-miR-4667-3p	CLIP-seq
MIRT1002882	hsa-miR-4698	CLIP-seq
MIRT1002883	hsa-miR-4720-5p	CLIP-seq
MIRT1002884	hsa-miR-4755-3p	CLIP-seq
MIRT1002885	hsa-miR-4797-5p	CLIP-seq
MIRT1002886	hsa-miR-4799-3p	CLIP-seq
MIRT1002887	hsa-miR-520d-5p	CLIP-seq
MIRT1002888	hsa-miR-522	CLIP-seq
MIRT1002889	hsa-miR-524-5p	CLIP-seq
MIRT1002890	hsa-miR-642a	CLIP-seq
MIRT1002891	hsa-miR-888	CLIP-seq
MIRT1997308	hsa-miR-153	CLIP-seq
MIRT1997309	hsa-miR-15a	CLIP-seq
MIRT1997310	hsa-miR-15b	CLIP-seq
MIRT1997311	hsa-miR-16	CLIP-seq
MIRT1997312	hsa-miR-183	CLIP-seq
MIRT1997313	hsa-miR-1910	CLIP-seq
MIRT1997314	hsa-miR-194	CLIP-seq
MIRT1997315	hsa-miR-195	CLIP-seq
MIRT1997316	hsa-miR-3120-3p	CLIP-seq
MIRT1997317	hsa-miR-3168	CLIP-seq
MIRT1997318	hsa-miR-3689a-5p	CLIP-seq
MIRT1997319	hsa-miR-3689b	CLIP-seq
MIRT1997320	hsa-miR-3689e	CLIP-seq
MIRT1997321	hsa-miR-3689f	CLIP-seq
MIRT1997322	hsa-miR-380	CLIP-seq
MIRT1997323	hsa-miR-3919	CLIP-seq
MIRT1997324	hsa-miR-3973	CLIP-seq
MIRT1997325	hsa-miR-411	CLIP-seq
MIRT1997326	hsa-miR-424	CLIP-seq
MIRT1997327	hsa-miR-4330	CLIP-seq
MIRT1997328	hsa-miR-4495	CLIP-seq
MIRT1997329	hsa-miR-4719	CLIP-seq
MIRT1997330	hsa-miR-490-3p	CLIP-seq
MIRT1997331	hsa-miR-495	CLIP-seq
MIRT1997332	hsa-miR-497	CLIP-seq
MIRT1997333	hsa-miR-513a-3p	CLIP-seq
MIRT1997334	hsa-miR-513b	CLIP-seq
MIRT1997335	hsa-miR-649	CLIP-seq
MIRT1997309	hsa-miR-15a	CLIP-seq
MIRT1997310	hsa-miR-15b	CLIP-seq
MIRT1997311	hsa-miR-16	CLIP-seq
MIRT1997312	hsa-miR-183	CLIP-seq
MIRT1997313	hsa-miR-1910	CLIP-seq
MIRT1997315	hsa-miR-195	CLIP-seq
MIRT2231035	hsa-miR-2053	CLIP-seq
MIRT2231036	hsa-miR-223	CLIP-seq
MIRT1997316	hsa-miR-3120-3p	CLIP-seq
MIRT2231037	hsa-miR-330-3p	CLIP-seq
MIRT2231038	hsa-miR-3691-3p	CLIP-seq
MIRT2231039	hsa-miR-374c	CLIP-seq
MIRT1997326	hsa-miR-424	CLIP-seq
MIRT2231040	hsa-miR-4328	CLIP-seq
MIRT2231041	hsa-miR-4697-3p	CLIP-seq
MIRT1997329	hsa-miR-4719	CLIP-seq
MIRT1997330	hsa-miR-490-3p	CLIP-seq
MIRT2231042	hsa-miR-494	CLIP-seq
MIRT1997332	hsa-miR-497	CLIP-seq
MIRT2231043	hsa-miR-499-3p	CLIP-seq
MIRT2231044	hsa-miR-5095	CLIP-seq
MIRT2231045	hsa-miR-561	CLIP-seq
MIRT2231046	hsa-miR-600	CLIP-seq
MIRT2231047	hsa-miR-630	CLIP-seq
MIRT1997335	hsa-miR-649	CLIP-seq
MIRT2231048	hsa-miR-655	CLIP-seq
MIRT2388159	hsa-miR-2116	CLIP-seq
MIRT2534906	hsa-miR-1185	CLIP-seq
MIRT2534907	hsa-miR-1282	CLIP-seq
MIRT2534908	hsa-miR-1283	CLIP-seq
MIRT2534909	hsa-miR-186	CLIP-seq
MIRT2534910	hsa-miR-204	CLIP-seq
MIRT2534911	hsa-miR-211	CLIP-seq
MIRT2534912	hsa-miR-3145-5p	CLIP-seq
MIRT2534913	hsa-miR-3148	CLIP-seq
MIRT2534914	hsa-miR-3163	CLIP-seq
MIRT2534915	hsa-miR-3184	CLIP-seq
MIRT2534916	hsa-miR-3189-5p	CLIP-seq
MIRT1002866	hsa-miR-320a	CLIP-seq
MIRT1002867	hsa-miR-320b	CLIP-seq
MIRT1002868	hsa-miR-320c	CLIP-seq
MIRT1002869	hsa-miR-320d	CLIP-seq
MIRT2534917	hsa-miR-335	CLIP-seq
MIRT2534918	hsa-miR-3605-5p	CLIP-seq
MIRT2534919	hsa-miR-3613-3p	CLIP-seq
MIRT2534920	hsa-miR-3616-5p	CLIP-seq
MIRT2534921	hsa-miR-3619-3p	CLIP-seq
MIRT2534922	hsa-miR-3647-5p	CLIP-seq
MIRT2534923	hsa-miR-3658	CLIP-seq
MIRT2534924	hsa-miR-3662	CLIP-seq
MIRT2534925	hsa-miR-3679-5p	CLIP-seq
MIRT2534926	hsa-miR-3681	CLIP-seq
MIRT2534927	hsa-miR-3682-3p	CLIP-seq
MIRT2534928	hsa-miR-3714	CLIP-seq
MIRT1002873	hsa-miR-371b-5p	CLIP-seq
MIRT2534929	hsa-miR-3922-5p	CLIP-seq
MIRT2534930	hsa-miR-423-5p	CLIP-seq
MIRT2534931	hsa-miR-4287	CLIP-seq
MIRT1002877	hsa-miR-4429	CLIP-seq
MIRT2534932	hsa-miR-4469	CLIP-seq
MIRT2534933	hsa-miR-4503	CLIP-seq
MIRT1002880	hsa-miR-4639-5p	CLIP-seq
MIRT2534934	hsa-miR-4655-3p	CLIP-seq
MIRT2534935	hsa-miR-4668-3p	CLIP-seq
MIRT2534936	hsa-miR-4685-3p	CLIP-seq
MIRT2534937	hsa-miR-4687-3p	CLIP-seq
MIRT1002882	hsa-miR-4698	CLIP-seq
MIRT2534938	hsa-miR-4700-3p	CLIP-seq
MIRT2534939	hsa-miR-4717-5p	CLIP-seq
MIRT2534940	hsa-miR-4758-3p	CLIP-seq
MIRT2534941	hsa-miR-4760-5p	CLIP-seq
MIRT2534942	hsa-miR-4762-3p	CLIP-seq
MIRT2534943	hsa-miR-4795-5p	CLIP-seq
MIRT2231042	hsa-miR-494	CLIP-seq
MIRT2231043	hsa-miR-499-3p	CLIP-seq
MIRT2534944	hsa-miR-508-5p	CLIP-seq
MIRT2231044	hsa-miR-5095	CLIP-seq
MIRT2534945	hsa-miR-514	CLIP-seq
MIRT2534946	hsa-miR-514b-3p	CLIP-seq
MIRT2534947	hsa-miR-520g	CLIP-seq
MIRT1002888	hsa-miR-522	CLIP-seq
MIRT2534948	hsa-miR-548aa	CLIP-seq
MIRT2534949	hsa-miR-548ae	CLIP-seq
MIRT2534950	hsa-miR-548aj	CLIP-seq
MIRT2534951	hsa-miR-548am	CLIP-seq
MIRT2534952	hsa-miR-548x	CLIP-seq
MIRT2534953	hsa-miR-568	CLIP-seq
MIRT2534954	hsa-miR-573	CLIP-seq
MIRT2231046	hsa-miR-600	CLIP-seq
MIRT2534955	hsa-miR-605	CLIP-seq
MIRT2231047	hsa-miR-630	CLIP-seq
MIRT1002891	hsa-miR-888	CLIP-seq
MIRT2681111	hsa-miR-1183	CLIP-seq
MIRT2534906	hsa-miR-1185	CLIP-seq
MIRT1002862	hsa-miR-1224-3p	CLIP-seq
MIRT2681112	hsa-miR-1278	CLIP-seq
MIRT2681113	hsa-miR-128	CLIP-seq
MIRT2534907	hsa-miR-1282	CLIP-seq
MIRT2681114	hsa-miR-1324	CLIP-seq
MIRT2681115	hsa-miR-145	CLIP-seq
MIRT2534909	hsa-miR-186	CLIP-seq
MIRT2681116	hsa-miR-1915	CLIP-seq
MIRT2534910	hsa-miR-204	CLIP-seq
MIRT2534911	hsa-miR-211	CLIP-seq
MIRT2681117	hsa-miR-27a	CLIP-seq
MIRT2681118	hsa-miR-27b	CLIP-seq
MIRT2534912	hsa-miR-3145-5p	CLIP-seq
MIRT2534913	hsa-miR-3148	CLIP-seq
MIRT2681119	hsa-miR-3160-5p	CLIP-seq
MIRT2534914	hsa-miR-3163	CLIP-seq
MIRT2681120	hsa-miR-3180-5p	CLIP-seq
MIRT2534915	hsa-miR-3184	CLIP-seq
MIRT2534916	hsa-miR-3189-5p	CLIP-seq
MIRT1002866	hsa-miR-320a	CLIP-seq
MIRT1002867	hsa-miR-320b	CLIP-seq
MIRT1002868	hsa-miR-320c	CLIP-seq
MIRT1002869	hsa-miR-320d	CLIP-seq
MIRT2534917	hsa-miR-335	CLIP-seq
MIRT2681121	hsa-miR-338-5p	CLIP-seq
MIRT2681122	hsa-miR-340	CLIP-seq
MIRT2534918	hsa-miR-3605-5p	CLIP-seq
MIRT2534919	hsa-miR-3613-3p	CLIP-seq
MIRT2534920	hsa-miR-3616-5p	CLIP-seq
MIRT2534921	hsa-miR-3619-3p	CLIP-seq
MIRT2534922	hsa-miR-3647-5p	CLIP-seq
MIRT1002871	hsa-miR-365	CLIP-seq
MIRT2681123	hsa-miR-3653	CLIP-seq
MIRT2534923	hsa-miR-3658	CLIP-seq
MIRT2534924	hsa-miR-3662	CLIP-seq
MIRT2534925	hsa-miR-3679-5p	CLIP-seq
MIRT2534926	hsa-miR-3681	CLIP-seq
MIRT2534927	hsa-miR-3682-3p	CLIP-seq
MIRT2681124	hsa-miR-3690	CLIP-seq
MIRT1002873	hsa-miR-371b-5p	CLIP-seq
MIRT2681125	hsa-miR-409-3p	CLIP-seq
MIRT2534930	hsa-miR-423-5p	CLIP-seq
MIRT2534931	hsa-miR-4287	CLIP-seq
MIRT2681126	hsa-miR-4292	CLIP-seq
MIRT2681127	hsa-miR-4308	CLIP-seq
MIRT1002876	hsa-miR-4428	CLIP-seq
MIRT1002877	hsa-miR-4429	CLIP-seq
MIRT2681128	hsa-miR-4446-5p	CLIP-seq
MIRT2534932	hsa-miR-4469	CLIP-seq
MIRT2681129	hsa-miR-4487	CLIP-seq
MIRT2534933	hsa-miR-4503	CLIP-seq
MIRT2681130	hsa-miR-4511	CLIP-seq
MIRT1002879	hsa-miR-4527	CLIP-seq
MIRT1002880	hsa-miR-4639-5p	CLIP-seq
MIRT2534934	hsa-miR-4655-3p	CLIP-seq
MIRT2534935	hsa-miR-4668-3p	CLIP-seq
MIRT2681131	hsa-miR-4680-5p	CLIP-seq
MIRT2534936	hsa-miR-4685-3p	CLIP-seq
MIRT2534937	hsa-miR-4687-3p	CLIP-seq
MIRT2681132	hsa-miR-4693-5p	CLIP-seq
MIRT1002882	hsa-miR-4698	CLIP-seq
MIRT2534938	hsa-miR-4700-3p	CLIP-seq
MIRT2534939	hsa-miR-4717-5p	CLIP-seq
MIRT2681133	hsa-miR-4726-3p	CLIP-seq
MIRT2681134	hsa-miR-4747-5p	CLIP-seq
MIRT1002884	hsa-miR-4755-3p	CLIP-seq
MIRT2681135	hsa-miR-4755-5p	CLIP-seq
MIRT2534940	hsa-miR-4758-3p	CLIP-seq
MIRT2681136	hsa-miR-4759	CLIP-seq
MIRT2534941	hsa-miR-4760-5p	CLIP-seq
MIRT2534942	hsa-miR-4762-3p	CLIP-seq
MIRT2534943	hsa-miR-4795-5p	CLIP-seq
MIRT1002885	hsa-miR-4797-5p	CLIP-seq
MIRT2231042	hsa-miR-494	CLIP-seq
MIRT2231043	hsa-miR-499-3p	CLIP-seq
MIRT2534944	hsa-miR-508-5p	CLIP-seq
MIRT2231044	hsa-miR-5095	CLIP-seq
MIRT2534945	hsa-miR-514	CLIP-seq
MIRT2534946	hsa-miR-514b-3p	CLIP-seq
MIRT2681137	hsa-miR-520a-5p	CLIP-seq
MIRT2534947	hsa-miR-520g	CLIP-seq
MIRT1002888	hsa-miR-522	CLIP-seq
MIRT2681138	hsa-miR-525-5p	CLIP-seq
MIRT2681139	hsa-miR-532-5p	CLIP-seq
MIRT2534948	hsa-miR-548aa	CLIP-seq
MIRT2534949	hsa-miR-548ae	CLIP-seq
MIRT2534950	hsa-miR-548aj	CLIP-seq
MIRT2534951	hsa-miR-548am	CLIP-seq
MIRT2681140	hsa-miR-548b-3p	CLIP-seq
MIRT2534952	hsa-miR-548x	CLIP-seq
MIRT2534953	hsa-miR-568	CLIP-seq
MIRT2534954	hsa-miR-573	CLIP-seq
MIRT2231046	hsa-miR-600	CLIP-seq
MIRT2534955	hsa-miR-605	CLIP-seq
MIRT2231047	hsa-miR-630	CLIP-seq
MIRT2681141	hsa-miR-670	CLIP-seq
MIRT1002891	hsa-miR-888	CLIP-seq
MIRT2681142	hsa-miR-942	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
FOXC1	Unknown	17993506;21837767
KLF5	Unknown	21487104
PARP1	Repression	19281796
TSC22D3	Repression	20018851

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	17024043
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS
GO:0001568	Process	Blood vessel development	IEA
GO:0001659	Process	Temperature homeostasis	ISS	22510882
GO:0001678	Process	Intracellular glucose homeostasis	ISS	22510882
GO:0003676	Function	Nucleic acid binding	EXP	18786403
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	ISS	22510882
GO:0003700	Function	DNA-binding transcription factor activity	IDA	17024043
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IMP	31063815
GO:0005515	Function	Protein binding	IPI	11237865, 11353774, 15084259, 15220471, 15692560, 15890677, 17030088, 18235501, 18408765, 18786403, 19483080, 20543840, 24419615, 24983498, 25241761, 25609649, 28514442, 31063815, 33961781, 35271311, 35512704, 36931259
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	25009184
GO:0005634	Component	Nucleus	IDA	11311120, 12228231, 18680538, 20543840, 31063815
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	11237865, 11311120, 12228231, 20543840, 25009184, 31063815
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	ISS	22510882
GO:0005829	Component	Cytosol	ISS	22510882
GO:0005829	Component	Cytosol	TAS
GO:0006094	Process	Gluconeogenesis	IDA	16753578
GO:0006111	Process	Regulation of gluconeogenesis	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006473	Process	Protein acetylation	ISS	22510882
GO:0006914	Process	Autophagy	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IMP	31063815
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	ISS
GO:0008013	Function	Beta-catenin binding	IDA	15905404
GO:0008013	Function	Beta-catenin binding	IEA
GO:0008286	Process	Insulin receptor signaling pathway	IBA
GO:0008286	Process	Insulin receptor signaling pathway	IEA
GO:0008286	Process	Insulin receptor signaling pathway	ISS
GO:0009267	Process	Cellular response to starvation	IDA	20543840
GO:0009267	Process	Cellular response to starvation	ISS	22510882
GO:0010467	Process	Gene expression	IEA
GO:0010508	Process	Positive regulation of autophagy	IMP	20543840
GO:0030154	Process	Cell differentiation	IEA
GO:0031490	Function	Chromatin DNA binding	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	20543840
GO:0032868	Process	Response to insulin	IEA
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0032869	Process	Cellular response to insulin stimulus	ISS
GO:0032873	Process	Negative regulation of stress-activated MAPK cascade	IDA	19696738
GO:0034393	Process	Positive regulation of smooth muscle cell apoptotic process	ISS
GO:0034599	Process	Cellular response to oxidative stress	IEA
GO:0034599	Process	Cellular response to oxidative stress	ISS
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IMP	20543840
GO:0043066	Process	Negative regulation of apoptotic process	IDA	10871843
GO:0043565	Function	Sequence-specific DNA binding	IDA	12228231
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045444	Process	Fat cell differentiation	ISS	22510882
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	ISS
GO:0045722	Process	Positive regulation of gluconeogenesis	IDA	17024043, 25009184
GO:0045722	Process	Positive regulation of gluconeogenesis	IEA
GO:0045732	Process	Positive regulation of protein catabolic process	IMP	20543840
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS	22510882
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	7862145, 10871843, 12228231
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10871843, 12228231
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	27577745
GO:0046676	Process	Negative regulation of insulin secretion	IEA
GO:0046676	Process	Negative regulation of insulin secretion	ISS
GO:0051721	Function	Protein phosphatase 2A binding	IEA
GO:0051721	Function	Protein phosphatase 2A binding	ISS
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060260	Process	Regulation of transcription initiation by RNA polymerase II	ISS
GO:0070417	Process	Cellular response to cold	ISS	22510882
GO:0070542	Process	Response to fatty acid	IEA
GO:0070542	Process	Response to fatty acid	ISS
GO:0071455	Process	Cellular response to hyperoxia	IDA	20543840
GO:0071732	Process	Cellular response to nitric oxide	IEA
GO:0071732	Process	Cellular response to nitric oxide	ISS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0097009	Process	Energy homeostasis	ISS	22510882
GO:0097150	Process	Neuronal stem cell population maintenance	IEA
GO:1903243	Process	Negative regulation of cardiac muscle hypertrophy in response to stress	ISS
GO:1990841	Function	Promoter-specific chromatin binding	IEA
GO:2000177	Process	Regulation of neural precursor cell proliferation	IEA
GO:2000377	Process	Regulation of reactive oxygen species metabolic process	IEA

Other IDs

• MIM: 136533
• HGNC: 3819
• e!Ensembl: ENSG00000150907

Protein

• UniProt ID: Q12778
• Protein name: Forkhead box protein O1 (Forkhead box protein O1A) (Forkhead in rhabdomyosarcoma)
• Protein function: Transcription factor that is the main target of insulin signaling and regulates metabolic homeostasis in response to oxidative stress (PubMed:10358076, PubMed:12228231, PubMed:15220471, PubMed:15890677, PubMed:18356527, PubMed:19221179, PubMed:2
• PDB: 3CO6, 3CO7, 3COA, 4LG0, 5DUI, 6LBI, 6QVW, 6QZR, 6QZS, 8A62, 8A65
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00250	Forkhead	160 → 247	Forkhead domain	Domain
  PF16675	FOXO_KIX_bdg	423 → 504	KIX-binding domain of forkhead box O, CR2	Family
  PF16676	FOXO-TAD	595 → 635	Transactivation domain of FOXO protein family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in umbilical endothelial cells (at protein level) (PubMed:19483080). Abundantly expressed in skeletal muscle and ovary, with lower expression in the heart, placenta, lung, liver, pancreas, spleen, testis and small intestine (
• Sequence:

  MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPS
  ASAAAVSADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHP
  APPQPPPPGPLSQHPPVPPAAAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKR
  LTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLN
  PEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPG
  SHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLP
  SLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPN
  YQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPV
  DPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLP
  HTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPS
  DLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG

• Sequence length: 655

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Malignant lymphoma, large B-cell, diffuse	Pathogenic	rs2501410449	RCV003318464	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FOXO1-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION, PULMONARY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATOCONUS	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYELOPROLIFERATIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASAL DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHABDOMYOSARCOMA 2	—	HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHABDOMYOSARCOMA, ALVEOLAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acne	Acne	BEFREE	28499891, 30144329, 30240097		★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	30144329, 30240097		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	27707884, 29622548		★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	23380710		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	17330099		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	17330099		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	29683733		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	30478420		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	18444242		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22653055		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	31027497		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	18444242, 22180177		★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	28641336		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	27707884		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	22343918, 23460611, 25909227		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	25043849, 28774833		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	28249601, 28641336		★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	10393185, 10439042, 10616906, 10718207, 10866659, 11059777, 11063797, 11735247, 11807989, 11863357, 12039929, 12183429, 12401804, 14697639, 15184910, 15660283, 15838707, 16157701, 16381018, 16452243, 16607381, 16645206, 16849537, 16952014, 16955479, 17097083, 17297479, 17490646, 17527077, 17922034, 18022385, 18303411, 18335505, 18561177, 18701482, 18973919, 19008039, 19047133, 19175284, 19199574, 19478459, 19704258, 19893043, 19904978, 19953635, 20231617, 20351326, 20453878, 20663909, 21128778, 21177767, 21220470, 21254373, 21321994, 21440083, 21666686, 21882254, 22037868, 22374423, 22447499, 22533991, 22710718, 23079386, 23372815, 23432728, 23645752, 23733015, 23797277, 23799156, 23814486, 24089019, 24113309, 24427371, 24486246, 24550147, 24608324, 24614150, 25398439, 25659124, 25912319, 26008753, 26071485, 26316324, 26355893, 26473193, 27261335, 27588498, 27760049, 27799565, 27840956, 27864345, 28615069, 28646473, 28883017, 29146205, 29214757, 29277758, 29367756, 29861864, 30190424, 30739374, 31099166, 31299267, 31426421, 7530783, 7536457, 7624119, 7862145, 8634710, 8643596, 8789435, 8790412, 8875708, 8889501, 8917562, 9010221, 9223312, 9294613, 9543674, 9546061, 9721857, 9823299		★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	LHGDN	12039929, 15140004, 16157701, 16952014, 17285543, 18303411		★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	GENOMICS_ENGLAND_DG	25768946		★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	Orphanet			★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	25364236, 35154571, 36988771	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyloidosis	Amyloidosis	BEFREE	22057897		★☆☆☆☆ Found in Text Mining only
amyloidosis IX	Amyloidosis	Pubtator	34552661	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	23469062	Associate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	28249601, 28641336, 29812970		★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	28691928		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	25414190		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	25591761, 25623117, 26068418, 30227407, 31217876		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	29439675	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	29439675		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	28249601, 28641336		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	25420919, 25849138, 26226438, 30825235, 31048182, 31450612, 31765819		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	25420919		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	37493406	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17873969, 22736089, 32879318, 38029456	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	29129636	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	37506143	Inhibit	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	28993609, 30288751		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	Pubtator	23874926	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	35879366	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	25273948	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	25420919, 25849138, 26226438, 30825235, 31048182, 31450612, 31765819		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	16916907, 21900687, 24704539, 27526027, 35458760	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	29423132	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	24453252, 26616563, 27332731, 27791035		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	30678091	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	24614102, 24977668, 29104634, 29545835		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	24801147		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25888950, 28087474, 28624205, 29409027, 31714185, 31769229		★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	29214757	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	16006742, 30579831		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	17442120		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	17442120	Associate	★☆☆☆☆ Found in Text Mining only
Brain Tumor, Primary	Brain Neoplasms	BEFREE	30664534		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11030146, 12560069, 14527951, 19633686, 21670150, 22675169, 24398626, 24886245, 25017439, 26919657, 28096479, 28397066, 28719355, 30799084, 31539530, 31739580, 31827405, 31844113		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	14527951, 19574223, 20551062, 22272226, 25017439, 26919657, 28096479, 29796115, 32207860, 33519190, 35637961, 35800988, 36539739, 36602390, 36901916, 37640964	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	28465297, 31300419, 35079069	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	30333121, 31557894		★☆☆☆☆ Found in Text Mining only
Calcification of Joints and Arteries	Calcinosis	Pubtator	32375544	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	32375544	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15184910, 27268017, 28099936, 28249601, 30001537, 32236623, 32716350, 33627785	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	25674275, 28887603	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	29695401	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	23435205	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23255113, 25053419, 25472505, 25739100, 30009772, 30092792, 35761036, 35805200, 36359865, 37099251, 39383136	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29879025	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	16341149	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25888950, 28087474, 28624205, 29409027, 31714185, 31769229		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23615915, 23888319, 24452601, 26572153, 27966721, 28713921, 30001537, 31217928		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	31823759, 32224523	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	25623117	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	30227407	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25202916	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22159921, 28664915, 29155058, 29286125, 30614794, 31823759		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	30083183		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	37967839	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	26956801, 30078216, 30132505, 31249632		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	26956801, 30078216, 31765819		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	30423812	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	25273948	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Thrombosis	Carotid artery thrombosis	Pubtator	31450612	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	25273948		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	21075101	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	37493406	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	30259675		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	36577299	Stimulate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	24423924, 26125868, 26214423, 31302815		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	26125868, 29035878		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	24423924, 26125868, 26214423, 29762826, 31302815		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	27707884		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	16767220, 29466794		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	29466794, 35609322, 36848245	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28506762, 31688999, 31714893		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30559170		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	17478621		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	20965933, 28578881, 29138552		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	30413788		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	24895270	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	31467256		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	20392999, 22180177, 24628039, 30535125, 31030593		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	22180177	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	31030593		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22180177, 29341479, 30071508, 30613961, 31030593		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30535125	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32221048, 36303457, 40314832	Associate	★☆☆☆☆ Found in Text Mining only
Congenital fusion of ribs	Rib fusion	BEFREE	16952014		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28781146		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20095040, 22213032, 28582447, 29545479, 31400752		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30825235		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	24489705	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	24489705		★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	21483870	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	30964354		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	30964354	Inhibit	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29444976		★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	29885845		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29302075		★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic Tumor	BEFREE	24486246, 9344317		★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic small round cell tumor	Pubtator	24517889	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15272020, 16997836, 23002242, 23705021, 28057752, 28267275, 28285015, 28738518, 28775125, 28781146, 29654945, 29724916, 30279162, 30510624, 30523026, 30689742, 30904630, 30968599, 31096186, 31118273, 31527256		★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	35154571	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	30558244, 31261027	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15272020, 16997836, 23002242, 23705021, 28057752, 28223216, 28267275, 28285015, 28738518, 28775125, 28781146, 29042442, 29654945, 29724916, 30279162, 30510624, 30523026, 30689742, 30904630, 30968599, 31096186, 31118273, 31506178, 31527256, 31836014		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	25674226, 31864032, 36577299, 36978091, 37335063	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	36303457, 39464889	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	26337673, 26386696, 28049237, 28733598, 28860538	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	27491024, 28505239, 30186875, 30279162, 30360646, 30790508		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16497530, 17555999, 19141580, 19346957, 20736318, 21442235, 21816244, 22140505, 23959366, 26337673, 28049237, 28432716, 28860538, 29724916, 30041644, 30487265, 30824102		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	30078216, 30132505		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	28860538, 30987438, 36626516	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	23401241, 28505239, 28860538, 29334763, 29355652, 29701296, 30962862, 30987438, 31629675, 31647955		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	28283331, 28508859		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	22343918, 23460611, 25909227, 26585955, 27132507		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	27928692		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	19463968, 21816244		★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	24746199		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	10718207, 11807989, 12550761, 15313887, 17471488, 18335505, 19478459, 20351326, 20701800, 24614150, 24793135, 25446247, 26473193, 28646473		★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	LHGDN	15184910, 17285543		★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	15987820		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	17599040, 19041124, 19574223, 20028871, 25698082, 26626801, 27636742, 28356952, 30019459, 30206735		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	17599040, 18096667		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	18096667, 19041124, 34233525, 35717540, 36047377	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	20028871	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	22072736		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	15501904, 22072736, 25546156		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	29286125, 31823759		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	30478420		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	19360286	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	30478420		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	28188753	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	10810459, 17334332, 17431644, 23995784, 24846856, 7887445		★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	30478420	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	16997836, 29320745, 31246177		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	33449950	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	30009772	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	23147115, 27935258, 30009772		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28527877, 29248466, 29323718		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	29545835		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	26396484, 27928692		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	26396484	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	23874926, 24771221, 25566967, 26449824, 36602390	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24771221, 24792437, 25566967, 29207098, 29286123, 30046342, 30216501		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24771221, 24792437, 25566967, 29207098, 29286123, 30046342, 30216501, 30700763		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19549905, 27835585, 30216501, 30272254, 30453847, 30664534, 30841958		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23874926, 26449824, 27448972, 30015885, 30024610, 30841958, 31098771, 32902145, 36602390	Associate	★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	36978091	Associate	★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	BEFREE	26061565		★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	26213859	Inhibit	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	27688110	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	24704539	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28781146		★☆☆☆☆ Found in Text Mining only
Heart Septal Defects	Heart Septal Defects	BEFREE	30423812		★☆☆☆☆ Found in Text Mining only
Heart Septal Defects	Congenital heart septal defect	Pubtator	30423812	Associate	★☆☆☆☆ Found in Text Mining only
Heart Septal Defects Ventricular	Congenital heart septal defect	Pubtator	30423812	Associate	★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	22996814, 29569762		★☆☆☆☆ Found in Text Mining only
Hemangioma, Intramuscular	Hemangioma	BEFREE	22996814		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	30801864	Associate	★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic encephalopathy	Pubtator	36424620	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	21697492, 24478438	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	32332845	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	22343918, 24977668	Inhibit	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	25043849, 28774833, 29721381		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	25232062, 27166193, 29439954	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	21926467, 22337954, 28973411		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	28973411	Stimulate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	35154571	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	29320745		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	19584310, 21816244, 23316693, 25420919, 25849138, 27412556, 28666105, 29062272, 29128891, 30360646, 30424007, 30465059, 31068817, 31096186, 31450545		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	31828164	Inhibit	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	36577299, 36626516	Associate	★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	31085234		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	19758991, 23316693, 28135285, 29324300		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	28135285	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	31246177		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	25273948, 32888289	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	25344740, 30524295, 30686655		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	20068066, 29843131	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37713813	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28467929, 30481487, 30683943, 31437238		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	36578501	Inhibit	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	38252663	Associate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	24453252		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31467256		★☆☆☆☆ Found in Text Mining only
Infantile hemangioma	Hemangioma	BEFREE	29569762		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	36303457	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29331376		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	26386696, 29414761, 31547433, 34034759, 34946711, 35154571, 37409718, 38102588	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	30790508		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	30790508, 35094651, 35840955, 40510349	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	30790508		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	30404794		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	23291589, 24265017, 25675348		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Keratoconus	Keratoconus	CTD_human_DG	23291589		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Keratoconus	Keratoconus	Pubtator	26040312, 28207827, 38267912	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	22042699		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	30588609		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	27736906, 30308195, 31655022		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	37528416	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	25008564	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	27751825		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	19772960, 31288815	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	21418583, 40420801	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	29622548		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	36282572	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24923295, 35941390	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	12921955		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	17330099		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	23380710, 28710059, 29442453, 9010221		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	29966750		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	23618529, 28099936		★☆☆☆☆ Found in Text Mining only
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	31095939		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21298325, 23255113, 24631529, 25472505, 25739100, 26893361, 27108614, 27329843, 27490929, 27924058, 28876084, 28972178, 29256045, 29707114, 29879025, 29940761, 30509085, 30828264, 30975706, 31021172, 31539182		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	29879025, 37464780	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	21298325		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	32457348	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23888319, 26572153, 30001537	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17873969, 27816669	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	17873969, 27816669, 28837808, 31673979		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	26799193, 30308195, 30648253		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21505104	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	29512706, 30333121		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	31300419	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	30520026, 33327711, 35079069, 36994552	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	22343918		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	23460611, 29721381, 30020823		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	23460611		★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	15184910, 17490646		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	22343918		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	30406026		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11030146, 12560069, 14527951, 19633686, 21670150, 21873240, 22675169, 24398626, 24886245, 25017439, 26919657, 28096479, 28397066, 28719355, 30799084, 31539530, 31739580, 31827405, 31844113		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	17599040, 19041124, 20028871, 25698082, 26626801, 27636742, 28356952, 30206735		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	30478420		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30272296, 30975706, 31105827		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23615915, 23888319, 24452601, 26572153, 27966721, 28713921, 30001537, 31217928		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	23618529, 28099936		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22159921, 29155058, 30614794		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	24419059, 26166196, 29852290, 30519351		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12351634, 12482965, 16849544, 19377286, 21505104, 21969818, 24260486, 24633705, 28986382, 29131261, 29676828, 30272279, 30405806, 31410199		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	29662167		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	28249743		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21696576, 23721824, 24202965, 24673584, 25596089, 25761483, 26448177, 26472729, 28970066, 31416776		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	25749387		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	19543511, 25888950, 28087474, 28624205, 29409027, 31714185, 31769229		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16849544, 18022385, 18701482, 19543511, 19893043, 20663909, 21969818, 22065083, 25330112, 26068418, 26214423, 27864345, 27994032, 28099936, 28249601, 28279977, 28446439, 28876084, 28965871, 28986382, 29146205, 30020823, 30227407, 30373318, 30664534, 31285436, 31302815, 31739580, 31844113, 9345057, 9405676		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	24423924, 26125868, 26214423, 31302815		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	20392999, 24628039, 24865442, 30535125, 31030593		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19574223, 20551062		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	22343918		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	26261511		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	26261511, 36303457	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29302075		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	30406026		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	20615072, 30201683		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	23025577	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	18497882, 23147115, 24489705		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	29466794, 35342363	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	30367995		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	31261027	Stimulate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	30227407	Inhibit	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	28099936	Associate	★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	22343918		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	27312110	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	28710059		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	32772642, 36290822, 40420801	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	22207735, 24806995		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	24956219		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	24956219		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	30083183		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	18570662, 35562411, 36061358	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	27095304, 31754475		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10393185, 10718207, 12150827, 12242297, 15668399, 15688409, 15838707, 16157701, 16287709, 16381018, 16849537, 16849544, 17311532, 17431644, 17986608, 18335505, 18701482, 18788888, 19047133, 19150107, 19295433, 19513505, 19549905, 19574223, 19704258, 19893043, 20028871, 20453878, 20663909, 21177767, 21254373, 21505104, 21762516, 21873240, 21969818, 21980390, 22197543, 22213032, 22343918, 22653055, 23029264, 23079386, 23432728, 23814486, 23995784, 24149177, 24398626, 24608324, 24631529, 24633705, 24746199, 24793135, 25141867, 25232062, 25311537, 25368019, 25398439, 25674275, 25761483, 25806826, 26055813, 26068418, 26125868, 26448177, 26472729, 26524723, 26572153, 27095304, 27323832, 27588498, 27636742, 27653874, 27658568, 27966721, 28087474, 28138962, 28279977, 28483946, 28876084, 28887603, 28972178, 28986382, 29238041, 29256045, 29309928, 29341479, 29367756, 29473160, 29545479, 29721381, 29928335, 30138596, 30272279, 30333121, 30453847, 30478420, 30565669, 30664534, 30739374, 30799084, 30828264, 31217876, 31426421, 31493794, 31579447, 31754475, 7576194, 8917562, 9098647, 9721857		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	30588609		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	16952014		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	16133873, 21354306, 31696486, 35163437	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	19214114, 31696486		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	19714246	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	19714246		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	24486246		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	31739580		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28527877, 30186875, 30664220, 31579588, 31782176		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19513505, 24705809, 25311537, 25983004, 26036758, 26303949, 26548866, 27880728, 30001537, 30618730, 31844042		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	18316359, 29224910, 30009772		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	15272020, 22223069, 26337673, 26727107, 28049237, 28866049, 29062272, 29773555, 30511639, 30526049, 30535458		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	22797373	Inhibit	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23025577, 26337673, 26386696, 28049237, 31547433, 32555314	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	32281255	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	28161531		★☆☆☆☆ Found in Text Mining only
Osteolysis	Osteolysis	Pubtator	29338713	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	26700816, 29115382		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	32404197	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	23867395, 38343056	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25416447, 27622707, 28160461, 28911141, 29901128, 30697272		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	29155058		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	33694202	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	16979636, 28453298		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	22159921, 30614794		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18319717, 23574718, 24870723, 25483711, 30614794, 32016462, 32192517, 37120633, 38143770	Associate	★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	24424889		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	24419059, 26166196, 29852290, 30519351		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	25591761, 25623117, 26068418, 30227407, 31217876		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	24419059		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	32181755	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	26617698, 27258970, 29075860		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	22761592, 29966750, 31036506		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	28845602, 29431075		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	37175429	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	27512949, 28845602		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	27512949, 36299623	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	32375544	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	23677673		★☆☆☆☆ Found in Text Mining only
Piebaldism	Piebaldism	BEFREE	30664534		★☆☆☆☆ Found in Text Mining only
Plexiform leiomyoma	Plexiform leiomyoma	GWASCAT_DG	30194396, 31649266		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	20406953, 26283014, 27845161, 30964354, 31185267		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	30964354, 33287836	Inhibit	★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	29622548		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	16979636		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	24741631		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	24741631		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	31582213		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12482965, 16849544, 19377286, 21505104, 21969818, 24260486, 24633705, 27164937, 28986382, 29676828, 30272279, 30405806, 31410199		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12351634, 12482965, 14726521, 15692560, 17597184, 19075016, 19377286, 19574223, 20623629, 21505104, 21969818, 23029264, 23389878, 23951320, 24260486, 29131261, 32264916, 32704044, 34552661, 36720852, 37131239	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12482965, 14726521, 15692560, 16849544, 17597184		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	29662167		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	21116854, 30998985		★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30683943		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	31437238	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	18415806	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	27526027, 29138552, 32982206	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	22213032, 28582447, 29545479		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	30590718		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	37925496	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	30783090		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	36577299	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	19047133, 21174601, 28445155, 30509085		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	10393185, 10718207, 10871843, 11063797, 11556833, 11807989, 11863357, 12039929, 12239174, 12242297, 12394275, 12550764, 15342383, 15492844, 15688409, 16337856, 16365729, 16849537, 17081294, 17334332, 17350164, 17431644, 17652054, 18094995, 18303411, 18457914, 18708938, 19047133, 19295433, 19953635, 20068066, 20663909, 21924226, 22089931, 22197543, 22454413, 22504834, 22564868, 23079386, 23255356, 23435416, 23526739, 24149177, 24292683, 24326270, 24797362, 25368019, 25806826, 25810375, 26179572, 26199390, 26209235, 26412593, 27488535, 27688110, 27799565, 27864345, 27984116, 28035744, 28138962, 28256213, 28380437, 28446439, 28521080, 28615069, 28646473, 29898687, 30093562, 30190424, 30307360, 30373318, 30762282, 30806137, 31113472, 31325529, 31456361, 31480361, 31493794, 31578374, 31824851, 7536457, 7862145, 9164192, 9546061, 9721857, 9766674		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	11556833, 20068066, 20663909, 22089931, 22447499, 23435416, 25768946, 25806826, 26226845, 26473193, 27799565, 28521080, 28615069, 29461635, 29898687, 30793977, 31480361, 31493794, 32187044, 32697014, 33216382, 33372065, 33627785, 34095712, 34285060, 34836971, 34850536, 35857643, 35879366, 36044855, 36282590, 37315267, 37732905, 37858275, 38296742, 40076757, 7887445	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	LHGDN	15688409, 17638879, 18988640		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	10393185, 10666368, 12239174, 15184910, 15838707, 16645206, 16849537, 18973919, 19039198, 19442434, 19953635, 19995556, 20663909, 21128778, 21321994, 21666686, 22089931, 22447499, 22533991, 23469153, 23733015, 24427371, 24517889, 24551291, 24797362, 26355893, 27413008, 27799565, 28615069, 29214757, 31285436, 31870357, 32087612, 32144381, 32187044, 32342940, 32532875, 33368602, 33523558, 34552155, 35813575, 35857643, 35879366, 36229873, 36232302, 37315267, 37732905, 38102136, 38296742, 7495283, 8789435, 9223312, 9530337	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	28380437	Stimulate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Embryonal	Rhabdomyosarcoma	Pubtator	10666368, 15184910, 29214757, 39379998	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	17873969, 24812285		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	17471488, 20512480, 21254373, 25806826, 26355893, 27588498, 27688079, 28378394, 29898687, 7536457		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	25300797, 29580035, 36928336, 7887445	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	20933505, 24517889	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	30404794	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	23098692		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31492105, 31771622		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	34948236	Associate	★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	14697639, 22192800, 9344317		★☆☆☆☆ Found in Text Mining only
Solitary fibrous tumor	Solitary fibrous tumor	BEFREE	28887603		★☆☆☆☆ Found in Text Mining only
Spermatic Cord Torsion	Spermatic Cord Torsion	BEFREE	29411905		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	15639120		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30478420		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	27769097, 28539329, 29749437, 30478420		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23827155, 31583913	Associate	★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	16997836, 18316359, 21412813, 23147115, 29056338, 29320745, 31246177, 31824338		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	21696576, 23721824, 24202965, 24673584, 25596089, 25761483, 26448177, 26472729, 28970066, 31416776		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	17491598, 19697059, 21696576, 24374340, 27268017, 28343375, 32474511, 36475746	Associate	★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	BEFREE	29569762		★☆☆☆☆ Found in Text Mining only
Subfertility	Subfertility	BEFREE	27515096		★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	24865442		★☆☆☆☆ Found in Text Mining only
Sveinsson Chorioretinal Atrophy	Sveinsson chorioretinal atrophy	Pubtator	24865442	Inhibit	★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	19214114		★☆☆☆☆ Found in Text Mining only
Telangiectasia Hereditary Hemorrhagic	Hereditary hemorrhagic telangiectasia	Pubtator	37689549	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	31450612	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	26617698	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	30242671	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	23160481		★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	25749387	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29588373		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	38104484	Associate	★☆☆☆☆ Found in Text Mining only
Truncus Arteriosus, Persistent	Persistent truncus arteriosus	BEFREE	30509030		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	19543511, 25888950, 31714185, 31769229, 32678492, 33283616, 36293387, 36430344, 38073044	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	32993576	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	24423924, 26214423, 26617737, 29762826, 31302815	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	26524723, 28135285	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	GWASCAT_DG	30194396, 31649266		★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	24801147		★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	32375544	Associate	★☆☆☆☆ Found in Text Mining only
Venous Malformations Multiple Cutaneous and Mucosal	Venous malformation	Pubtator	32867785	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	32156832	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	31261027		★☆☆☆☆ Found in Text Mining only