Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	2214
Gene name	Fc gamma receptor IIIa
Gene symbol	FCGR3A
Synonyms (NCBI Gene)	CD16CD16-IICD16AFCG3FCGR3FCGRIIIFCR-10FCRIIIFCRIIIAFcGRIIIAIGFR3IMD20
Chromosome	1
Chromosome location	1q23.3
Summary	This gene encodes a receptor for the Fc portion of immunoglobulin G, and it is involved in the removal of antigen-antibody complexes from the circulation, as well as other responses, including antibody dependent cellular mediated cytotoxicity and antibody

SNP ID	Visualize variation	Clinical significance	Consequence
rs396991	A>C,G,T	Likely-benign, drug-response	Intron variant, coding sequence variant, missense variant

11 Show/Hide all (11)

miRTarBase ID	miRNA	Experiments
MIRT993883	hsa-miR-1292	CLIP-seq
MIRT993884	hsa-miR-1294	CLIP-seq
MIRT993885	hsa-miR-1301	CLIP-seq
MIRT993886	hsa-miR-3126-5p	CLIP-seq
MIRT993887	hsa-miR-4316	CLIP-seq
MIRT993888	hsa-miR-4419a	CLIP-seq
MIRT993889	hsa-miR-4510	CLIP-seq
MIRT993890	hsa-miR-4660	CLIP-seq
MIRT993891	hsa-miR-4677-3p	CLIP-seq
MIRT993892	hsa-miR-4738-3p	CLIP-seq
MIRT993893	hsa-miR-5047	CLIP-seq

34 Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001788	Process	Antibody-dependent cellular cytotoxicity	IBA
GO:0001788	Process	Antibody-dependent cellular cytotoxicity	IDA	11711607, 27670158, 28652325
GO:0001913	Process	T cell mediated cytotoxicity	ISS
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	2532305, 23006327, 23024279, 33961781, 34158475
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	24337742
GO:0005886	Component	Plasma membrane	IDA	1825220, 2532305, 23006327, 24337742, 27670158, 28652325
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	2138330
GO:0006955	Process	Immune response	TAS	2138330
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IDA	10706735, 24942581
GO:0016020	Component	Membrane	IEA
GO:0017038	Process	Protein import	IDA	20038786
GO:0019722	Process	Calcium-mediated signaling	IDA	23024279
GO:0019770	Function	IgG receptor activity	IBA
GO:0019772	Function	Low-affinity IgG receptor activity	IDA	11711607
GO:0019864	Function	IgG binding	IEA
GO:0030101	Process	Natural killer cell activation	IDA	9916693
GO:0030101	Process	Natural killer cell activation	IMP	23006327
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	10728755
GO:0032819	Process	Positive regulation of natural killer cell proliferation	IDA	9916693
GO:0033001	Component	Fc-gamma receptor III complex	IDA	1825220, 28652325
GO:0038094	Process	Fc-gamma receptor signaling pathway	IDA	8478617, 23024279
GO:0042116	Process	Macrophage activation	IDA	10728755
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IDA	10318937, 23006327
GO:0043320	Process	Natural killer cell degranulation	IDA	25786175, 28652325
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	23024279
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071806	Process	Protein transmembrane transport	IDA	20038786
GO:0140375	Function	Immune receptor activity	IDA	10318937
GO:0140507	Process	Granzyme-mediated programmed cell death signaling pathway	IDA	20038786

MIM	HGNC	e!Ensembl
146740	3619	ENSG00000203747

P08637

Protein name

Low affinity immunoglobulin gamma Fc region receptor III-A (IgG Fc receptor III-A) (CD16-II) (CD16a antigen) (Fc-gamma RIII-alpha) (Fc-gamma RIII) (Fc-gamma RIIIa) (FcRIII) (FcRIIIa) (FcgammaRIIIA) (FcR-10) (IgG Fc receptor III-2) (CD antigen CD16a)

Protein function

Receptor for the invariable Fc fragment of immunoglobulin gamma (IgG). Optimally activated upon binding of clustered antigen-IgG complexes displayed on cell surfaces, triggers lysis of antibody-coated cells, a process known as antibody-dependent

PDB

3AY4 , 3SGJ , 3SGK , 3WN5 , 5BW7 , 5D6D , 5ML9 , 5MN2 , 5VU0 , 5XJE , 5XJF , 5YC5 , 7SEG , 7URU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13895	Ig_2	27 → 104	Immunoglobulin domain	Domain
PF13895	Ig_2	108 → 190	Immunoglobulin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in natural killer cells (at protein level) (PubMed:2526846). Expressed in a subset of circulating monocytes (at protein level) (PubMed:27670158). {ECO:0000269|PubMed:2526846, ECO:0000269|PubMed:27670158}.

Sequence

MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQW
FHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKE
EDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKN
VSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDW
KDHKFKWRKDPQDK

Sequence length

254

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Phagosome	Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Osteoclast differentiation	FCGR activation
Neutrophil extracellular trap formation	Regulation of actin dynamics for phagocytic cup formation
Natural killer cell mediated cytotoxicity	Role of phospholipids in phagocytosis
Fc gamma R-mediated phagocytosis	FCGR3A-mediated IL10 synthesis
Leishmaniasis	FCGR3A-mediated phagocytosis
Staphylococcus aureus infection
Tuberculosis
Systemic lupus erythematosus

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (27)
ANTI-BASEMENT MEMBRANE GLOMERULONEPHRITIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC RHINITIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autosomal recessive primary immunodeficiency with defective spontaneous natural killer cell cytotoxicity	Uncertain significance	ClinVar CTD, ClinVar, Orphanet CTD, ClinVar, Orphanet	23006327, 23006327	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
BEHCET SYNDROME	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	CTD, Disgenet CTD, Disgenet	30097691	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GIANT CELL ARTERITIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAFT-VS-HOST DISEASE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 20	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS NEPHRITIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOSITIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYNEUROPATHY	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	38538606	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	38538606	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	36333501	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	28714469	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOCYTOPENIA DUE TO PLATELET ALLOIMMUNIZATION	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	33179336	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
FCGR2A	6	["Thrombocytopenia","Ischemic heart disease","Epilepsy","Giant cell arteritis","Iga nephropathy","Lupus nephritis"]	12	["Phagosome","Osteoclast differentiation","Neutrophil extracellular trap formation","Fc gamma R-mediated phagocytosis","Leishmaniasis","Staphylococcus aureus infection","Tuberculosis","Systemic lupus erythematosus","Regulation of actin dynamics for phagocytic cup formation","FCGR3A-mediated IL10 synthesis","Role of phospholipids in phagocytosis","FCGR activation"]	9	["Disgenet (Systemic lupus erythematosus)","Disgenet (Ischemic heart disease)","Disgenet (Coronary artery disease)","Disgenet (Crohn disease)","Disgenet (Epilepsy)","Disgenet (Giant cell arteritis)","Disgenet (Lupus nephritis)","Disgenet (Rheumatoid arthritis)","Disgenet (Thrombocytopenia)"]
FCGR1A	0	[]	13	["Phagosome","Osteoclast differentiation","Neutrophil extracellular trap formation","Fc gamma R-mediated phagocytosis","Leishmaniasis","Staphylococcus aureus infection","Tuberculosis","Systemic lupus erythematosus","Regulation of actin dynamics for phagocytic cup formation","Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell","FCGR3A-mediated IL10 synthesis","Role of phospholipids in phagocytosis"]	0	[]
IFNGR1	2	["Behcet disease","Immunodeficiency"]	4	["Osteoclast differentiation","Natural killer cell mediated cytotoxicity","Leishmaniasis","Tuberculosis"]	5	["Disgenet (Asthma)","Disgenet (Behcet disease)","HPO (Immunodeficiency)","Disgenet (Immunodeficiency)","CTD (Immunodeficiency)"]
SYK	2	["Arthritis","Immunodeficiency"]	10	["Osteoclast differentiation","Neutrophil extracellular trap formation","Natural killer cell mediated cytotoxicity","Fc gamma R-mediated phagocytosis","Tuberculosis","Regulation of actin dynamics for phagocytic cup formation","FCGR3A-mediated phagocytosis","FCGR3A-mediated IL10 synthesis","Role of phospholipids in phagocytosis","FCGR activation"]	3	["Disgenet (Arthritis)","HPO (Immunodeficiency)","Disgenet (Immunodeficiency)"]
IL21R	3	["Behcet disease","Giant cell arteritis","Immunodeficiency"]	0	[]	7	["Disgenet (Systemic lupus erythematosus)","Disgenet (Behcet disease)","Disgenet (Crohn disease)","Disgenet (Giant cell arteritis)","HPO (Immunodeficiency)","Disgenet (Immunodeficiency)","CTD (Immunodeficiency)"]

FCGR3A (Fc gamma receptor IIIa)

Bookmark This Gene