FAR2 (fatty acyl-CoA reductase 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 55711
• Gene name: Fatty acyl-CoA reductase 2
• Gene symbol: FAR2
• Synonyms (NCBI Gene): HEL-S-81, MLSTD1, SDR10E2
• Chromosome: 12
• Chromosome location: 12p11.22
• Summary: This gene belongs to the short chain dehydrogenase/reductase superfamily. It encodes a reductase enzyme involved in the first step of wax biosynthesis wherein fatty acids are converted to fatty alcohols. The encoded peroxisomal protein utilizes saturated

miRNA Show/Hide all (55)

miRTarBase ID	miRNA	Experiments	Reference
MIRT549780	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT549781	hsa-miR-8063	PAR-CLIP	21572407
MIRT549779	hsa-miR-4698	PAR-CLIP	21572407
MIRT525846	hsa-miR-371b-5p	PAR-CLIP	21572407
MIRT525845	hsa-miR-373-5p	PAR-CLIP	21572407
MIRT525844	hsa-miR-616-5p	PAR-CLIP	21572407
MIRT549778	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT549777	hsa-miR-3924	PAR-CLIP	21572407
MIRT549776	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT525848	hsa-miR-6715a-3p	PAR-CLIP	22012620
MIRT525847	hsa-miR-935	PAR-CLIP	22012620
MIRT525846	hsa-miR-371b-5p	PAR-CLIP	22012620
MIRT525845	hsa-miR-373-5p	PAR-CLIP	22012620
MIRT525844	hsa-miR-616-5p	PAR-CLIP	22012620
MIRT525843	hsa-miR-371a-5p	PAR-CLIP	22012620
MIRT525842	hsa-miR-372-5p	PAR-CLIP	22012620
MIRT525841	hsa-miR-4766-5p	PAR-CLIP	22012620
MIRT525840	hsa-miR-6895-3p	PAR-CLIP	22012620
MIRT525839	hsa-miR-593-3p	PAR-CLIP	22012620
MIRT525837	hsa-miR-6715b-3p	PAR-CLIP	22012620
MIRT525838	hsa-miR-6818-3p	PAR-CLIP	22012620
MIRT549780	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT549781	hsa-miR-8063	PAR-CLIP	21572407
MIRT549779	hsa-miR-4698	PAR-CLIP	21572407
MIRT525846	hsa-miR-371b-5p	PAR-CLIP	21572407
MIRT525845	hsa-miR-373-5p	PAR-CLIP	21572407
MIRT525844	hsa-miR-616-5p	PAR-CLIP	21572407
MIRT549778	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT549777	hsa-miR-3924	PAR-CLIP	21572407
MIRT549776	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT525848	hsa-miR-6715a-3p	PAR-CLIP	22012620
MIRT525847	hsa-miR-935	PAR-CLIP	22012620
MIRT525846	hsa-miR-371b-5p	PAR-CLIP	22012620
MIRT525845	hsa-miR-373-5p	PAR-CLIP	22012620
MIRT525844	hsa-miR-616-5p	PAR-CLIP	22012620
MIRT525843	hsa-miR-371a-5p	PAR-CLIP	22012620
MIRT525842	hsa-miR-372-5p	PAR-CLIP	22012620
MIRT525841	hsa-miR-4766-5p	PAR-CLIP	22012620
MIRT525840	hsa-miR-6895-3p	PAR-CLIP	22012620
MIRT525839	hsa-miR-593-3p	PAR-CLIP	22012620
MIRT525837	hsa-miR-6715b-3p	PAR-CLIP	22012620
MIRT525838	hsa-miR-6818-3p	PAR-CLIP	22012620
MIRT1993205	hsa-miR-128	CLIP-seq
MIRT1993206	hsa-miR-27a	CLIP-seq
MIRT1993207	hsa-miR-27b	CLIP-seq
MIRT1993208	hsa-miR-580	CLIP-seq
MIRT2449469	hsa-miR-1258	CLIP-seq
MIRT2449470	hsa-miR-3121-3p	CLIP-seq
MIRT2449471	hsa-miR-3163	CLIP-seq
MIRT2449472	hsa-miR-374c	CLIP-seq
MIRT2449473	hsa-miR-3945	CLIP-seq
MIRT2449474	hsa-miR-4261	CLIP-seq
MIRT2449475	hsa-miR-4496	CLIP-seq
MIRT2449476	hsa-miR-4761-3p	CLIP-seq
MIRT2449477	hsa-miR-655	CLIP-seq

Gene ontology (GO) Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005777	Component	Peroxisome	IBA
GO:0005777	Component	Peroxisome	IEA
GO:0005777	Component	Peroxisome	ISS
GO:0005778	Component	Peroxisomal membrane	IDA	24108123
GO:0005778	Component	Peroxisomal membrane	IEA
GO:0005778	Component	Peroxisomal membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0010025	Process	Wax biosynthetic process	IEA
GO:0010025	Process	Wax biosynthetic process	TAS
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016491	Function	Oxidoreductase activity	TAS
GO:0035336	Process	Long-chain fatty-acyl-CoA metabolic process	IBA
GO:0035336	Process	Long-chain fatty-acyl-CoA metabolic process	IDA	15220348
GO:0080019	Function	Alcohol-forming very long-chain fatty acyl-CoA reductase activity	IBA
GO:0080019	Function	Alcohol-forming very long-chain fatty acyl-CoA reductase activity	IDA	15220348
GO:0080019	Function	Alcohol-forming very long-chain fatty acyl-CoA reductase activity	IEA
GO:0102965	Function	Alcohol-forming long-chain fatty acyl-CoA reductase activity	IEA

Other IDs

• MIM: 616156
• HGNC: 25531
• e!Ensembl: ENSG00000064763

Protein

• UniProt ID: Q96K12
• Protein name: Fatty acyl-CoA reductase 2 (FAR2) (EC 1.2.1.84) (Male sterility domain-containing protein 1)
• Protein function: Catalyzes the reduction of saturated but not unsaturated C16 or C18 fatty acyl-CoA to fatty alcohols (FAls) (PubMed:15220348). A lower activity can be observed with shorter fatty acyl-CoA substrates (PubMed:15220348). Can produce very long-chain
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03015	Sterile	356 → 448	Male sterility protein	Family
  PF07993	NAD_binding_4	15 → 285	Male sterility protein	Family

• Sequence:

  MSTIAAFYGGKSILITGATGFLGKVLMEKLFRTSPDLKVIYILVRPKAGQTLQQRVFQIL
  DSKLFEKVKEVCPNVHEKIRAIYADLNQNDFAISKEDMQELLSCTNIIFHCAATVRFDDT
  LRHAVQLNVTATRQLLLMASQMPKLEAFIHISTAYSNCNLKHIDEVIYPCPVEPKKIIDS
  LEWLDDAIIDEITPKLIRDWPNIYTYTKALGEMVVQQESRNLNIAIIRPSIVGATWQEPF
  PGWVDNINGPNGIIIATGKGFLRAIKATPMAVADVIPVDTVVNLMLAVGWYTAVHRPKST
  LVYHITSGNMNPCNWHKMGVQVLATFEKIPFERPFRRPNANFTSNSFTSQYWNAVSHRAP
  AIIYDCYLRLTGRKPRMTKLMNRLLRTVSMLEYFINRSWEWSTYNTEMLMSELSPEDQRV
  FNFDVRQLNWLEYIENYVLGVKKYLLKEDMAGIPKAKQRLKRLRNIHYLFNTALFLIAWR
  LLIARSQMARNVWFFIVSFCYKFLSYFRASSTLKV

• Sequence length: 515

Pathways

KEGG Pathway:

Peroxisome

Reactome Pathway:

Wax biosynthesis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (15)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	35694926	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	28196072, 29146897, 30573740	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	31757997	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	31757997	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	35694926	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL TREMOR	—	GWAS catalog	27797806	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	37337107	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHY	—	GWAS catalog	31220337	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	40205036	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	40205036	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	39503264	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	38317187	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	38162683	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (13)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alopecia	Alopecia	BEFREE	30372477		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29652635		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	35462437	Inhibit	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	26459294		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29652635		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	26459294		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	27542345	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	29652635		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	32938960	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22801071	Associate	★☆☆☆☆ Found in Text Mining only
Pseudopelade	Pseudopelade	BEFREE	30372477		★☆☆☆☆ Found in Text Mining only
Scarring alopecia	Alopecia	BEFREE	30372477		★☆☆☆☆ Found in Text Mining only
Tremor	Tremor	Pubtator	34320404	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

FAR1 2 shared pathwaysPeroxisome, Wax biosynthesis Related via 2 shared pathways including Peroxisome, Wax biosynthesis. CCDC91 3 shared diseasesEssential tremor, Iga nephropathy, Myopathy 4 shared evidence sourcesGWAS catalog (Essential tremor), GWAS catalog (Iga nephropathy), GWAS catalog (Myopathy), GWAS catalog (Stroke) Related via 3 shared diseases including Essential tremor, Iga nephropathy — evidence mostly GWAS catalog. PKD1L3 2 shared diseasesEssential tremor, Iga nephropathy 1 shared evidence sourceGWAS catalog (Iga nephropathy) Related via 2 shared diseases including Essential tremor, Iga nephropathy — evidence mostly GWAS catalog. PSD3 2 shared diseasesEssential tremor, Iga nephropathy 2 shared evidence sourcesGWAS catalog (Essential tremor), GWAS catalog (Iga nephropathy) Related via 2 shared diseases including Essential tremor, Iga nephropathy — evidence mostly GWAS catalog. RANBP17 1 shared diseaseEssential tremor 2 shared evidence sourcesGWAS catalog (Essential tremor), GWAS catalog (Stroke) Related via 1 shared disease including Essential tremor — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
FAR1	0	[]	2	["Peroxisome","Wax biosynthesis"]	0	[]
CCDC91	3	["Essential tremor","Iga nephropathy","Myopathy"]	0	[]	4	["GWAS catalog (Essential tremor)","GWAS catalog (Iga nephropathy)","GWAS catalog (Myopathy)","GWAS catalog (Stroke)"]
PKD1L3	2	["Essential tremor","Iga nephropathy"]	0	[]	1	["GWAS catalog (Iga nephropathy)"]
PSD3	2	["Essential tremor","Iga nephropathy"]	0	[]	2	["GWAS catalog (Essential tremor)","GWAS catalog (Iga nephropathy)"]
RANBP17	1	["Essential tremor"]	0	[]	2	["GWAS catalog (Essential tremor)","GWAS catalog (Stroke)"]

Diseases Linked via Similar Genes

Attention deficit hyperactivity disorder Linked via 3 of 5 related genesCCDC91, PKD1L3, RANBP17 Autism Linked via 3 of 5 related genesCCDC91, PKD1L3, RANBP17 Prostate cancer Linked via 3 of 5 related genesCCDC91, PKD1L3, PSD3 Diabetes mellitus type 2 Linked via 3 of 5 related genesPKD1L3, PSD3, RANBP17 Coronary artery disease Linked via 2 of 5 related genesPKD1L3, PSD3

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Attention deficit hyperactivity disorder	3	["CCDC91","PKD1L3","RANBP17"]
Autism	3	["CCDC91","PKD1L3","RANBP17"]
Prostate cancer	3	["CCDC91","PKD1L3","PSD3"]
Diabetes mellitus type 2	3	["PKD1L3","PSD3","RANBP17"]
Coronary artery disease	2	["PKD1L3","PSD3"]