Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	55297
Gene name	Coiled-coil domain containing 91
Gene symbol	CCDC91
Synonyms (NCBI Gene)	HSD8p56
Chromosome	12
Chromosome location	12p11.22

140 Show/Hide all (140)

miRTarBase ID	miRNA	Experiments	Reference
MIRT625140	hsa-miR-8485	HITS-CLIP	23824327
MIRT625139	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT625138	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT629246	hsa-miR-5689	HITS-CLIP	23824327
MIRT625140	hsa-miR-8485	HITS-CLIP	23824327
MIRT625139	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT625138	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT629246	hsa-miR-5689	HITS-CLIP	23824327
MIRT625140	hsa-miR-8485	HITS-CLIP	23824327
MIRT625139	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT625138	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT629246	hsa-miR-5689	HITS-CLIP	23824327
MIRT625140	hsa-miR-8485	HITS-CLIP	23824327
MIRT625139	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT625138	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT629246	hsa-miR-5689	HITS-CLIP	23824327
MIRT625140	hsa-miR-8485	HITS-CLIP	23824327
MIRT625139	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT625138	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT625140	hsa-miR-8485	HITS-CLIP	23824327
MIRT625139	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT625138	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT629246	hsa-miR-5689	HITS-CLIP	23824327
MIRT625140	hsa-miR-8485	HITS-CLIP	23824327
MIRT625139	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT625138	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT629246	hsa-miR-5689	HITS-CLIP	23824327
MIRT625140	hsa-miR-8485	HITS-CLIP	23824327
MIRT625139	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT625138	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT629246	hsa-miR-5689	HITS-CLIP	23824327
MIRT625140	hsa-miR-8485	HITS-CLIP	23824327
MIRT625139	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT625138	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT629246	hsa-miR-5689	HITS-CLIP	23824327
MIRT625140	hsa-miR-8485	HITS-CLIP	23824327
MIRT625139	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT625138	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT870405	hsa-miR-1267	CLIP-seq
MIRT870406	hsa-miR-135a	CLIP-seq
MIRT870407	hsa-miR-135b	CLIP-seq
MIRT870408	hsa-miR-142-5p	CLIP-seq
MIRT870409	hsa-miR-188-3p	CLIP-seq
MIRT870410	hsa-miR-203	CLIP-seq
MIRT870411	hsa-miR-3074-3p	CLIP-seq
MIRT870412	hsa-miR-3119	CLIP-seq
MIRT870413	hsa-miR-3140-3p	CLIP-seq
MIRT870414	hsa-miR-335	CLIP-seq
MIRT870415	hsa-miR-340	CLIP-seq
MIRT870416	hsa-miR-361-5p	CLIP-seq
MIRT870417	hsa-miR-3664-5p	CLIP-seq
MIRT870418	hsa-miR-3689a-5p	CLIP-seq
MIRT870419	hsa-miR-3689b	CLIP-seq
MIRT870420	hsa-miR-3689e	CLIP-seq
MIRT870421	hsa-miR-3689f	CLIP-seq
MIRT870422	hsa-miR-369-3p	CLIP-seq
MIRT870423	hsa-miR-374a	CLIP-seq
MIRT870424	hsa-miR-374b	CLIP-seq
MIRT870425	hsa-miR-3973	CLIP-seq
MIRT870426	hsa-miR-410	CLIP-seq
MIRT870427	hsa-miR-4438	CLIP-seq
MIRT870428	hsa-miR-4452	CLIP-seq
MIRT870429	hsa-miR-450b-5p	CLIP-seq
MIRT870430	hsa-miR-4699-3p	CLIP-seq
MIRT870431	hsa-miR-4714-5p	CLIP-seq
MIRT870432	hsa-miR-4775	CLIP-seq
MIRT870433	hsa-miR-487a	CLIP-seq
MIRT870434	hsa-miR-494	CLIP-seq
MIRT870435	hsa-miR-507	CLIP-seq
MIRT870436	hsa-miR-518a-5p	CLIP-seq
MIRT870437	hsa-miR-520g	CLIP-seq
MIRT870438	hsa-miR-520h	CLIP-seq
MIRT870439	hsa-miR-527	CLIP-seq
MIRT870440	hsa-miR-532-3p	CLIP-seq
MIRT870441	hsa-miR-557	CLIP-seq
MIRT870442	hsa-miR-561	CLIP-seq
MIRT870443	hsa-miR-590-3p	CLIP-seq
MIRT870444	hsa-miR-653	CLIP-seq
MIRT1958396	hsa-miR-200b	CLIP-seq
MIRT1958397	hsa-miR-200c	CLIP-seq
MIRT1958398	hsa-miR-429	CLIP-seq
MIRT2195232	hsa-miR-1257	CLIP-seq
MIRT2195233	hsa-miR-181a	CLIP-seq
MIRT2195234	hsa-miR-181b	CLIP-seq
MIRT2195235	hsa-miR-181c	CLIP-seq
MIRT2195236	hsa-miR-181d	CLIP-seq
MIRT2195237	hsa-miR-4262	CLIP-seq
MIRT2195238	hsa-miR-4641	CLIP-seq
MIRT2195239	hsa-miR-4722-3p	CLIP-seq
MIRT2195240	hsa-miR-4793-5p	CLIP-seq
MIRT2195241	hsa-miR-520d-5p	CLIP-seq
MIRT2195242	hsa-miR-524-5p	CLIP-seq
MIRT2195232	hsa-miR-1257	CLIP-seq
MIRT870405	hsa-miR-1267	CLIP-seq
MIRT2498503	hsa-miR-127-5p	CLIP-seq
MIRT2498504	hsa-miR-132	CLIP-seq
MIRT870406	hsa-miR-135a	CLIP-seq
MIRT870407	hsa-miR-135b	CLIP-seq
MIRT870408	hsa-miR-142-5p	CLIP-seq
MIRT2195233	hsa-miR-181a	CLIP-seq
MIRT2195234	hsa-miR-181b	CLIP-seq
MIRT2195235	hsa-miR-181c	CLIP-seq
MIRT2195236	hsa-miR-181d	CLIP-seq
MIRT2498505	hsa-miR-186	CLIP-seq
MIRT870409	hsa-miR-188-3p	CLIP-seq
MIRT2498506	hsa-miR-2052	CLIP-seq
MIRT2498507	hsa-miR-212	CLIP-seq
MIRT870412	hsa-miR-3119	CLIP-seq
MIRT2498508	hsa-miR-3133	CLIP-seq
MIRT870413	hsa-miR-3140-3p	CLIP-seq
MIRT2498509	hsa-miR-3163	CLIP-seq
MIRT2498510	hsa-miR-33a	CLIP-seq
MIRT2498511	hsa-miR-33b	CLIP-seq
MIRT870415	hsa-miR-340	CLIP-seq
MIRT870417	hsa-miR-3664-5p	CLIP-seq
MIRT2498512	hsa-miR-3688-5p	CLIP-seq
MIRT2195237	hsa-miR-4262	CLIP-seq
MIRT2498513	hsa-miR-433	CLIP-seq
MIRT870427	hsa-miR-4438	CLIP-seq
MIRT870428	hsa-miR-4452	CLIP-seq
MIRT2498514	hsa-miR-4495	CLIP-seq
MIRT870429	hsa-miR-450b-5p	CLIP-seq
MIRT870431	hsa-miR-4714-5p	CLIP-seq
MIRT2195239	hsa-miR-4722-3p	CLIP-seq
MIRT870432	hsa-miR-4775	CLIP-seq
MIRT2195240	hsa-miR-4793-5p	CLIP-seq
MIRT870433	hsa-miR-487a	CLIP-seq
MIRT870435	hsa-miR-507	CLIP-seq
MIRT2498515	hsa-miR-548c-3p	CLIP-seq
MIRT870441	hsa-miR-557	CLIP-seq
MIRT870442	hsa-miR-561	CLIP-seq
MIRT870443	hsa-miR-590-3p	CLIP-seq
MIRT2498516	hsa-miR-664	CLIP-seq
MIRT2195232	hsa-miR-1257	CLIP-seq
MIRT2195233	hsa-miR-181a	CLIP-seq
MIRT2195234	hsa-miR-181b	CLIP-seq
MIRT2195235	hsa-miR-181c	CLIP-seq
MIRT2195236	hsa-miR-181d	CLIP-seq
MIRT2195237	hsa-miR-4262	CLIP-seq
MIRT2677515	hsa-miR-4766-5p	CLIP-seq

13 Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IBA
GO:0005802	Component	Trans-Golgi network	IDA	17596511
GO:0005829	Component	Cytosol	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0048193	Process	Golgi vesicle transport	IEA
GO:0090160	Process	Golgi to lysosome transport	IBA
GO:0090160	Process	Golgi to lysosome transport	IMP	17596511

MIM	HGNC	e!Ensembl
617366	24855	ENSG00000123106

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q7Z6B0
Protein name	Coiled-coil domain-containing protein 91 (GGA-binding partner) (p56 accessory protein)
Protein function	Involved in the regulation of membrane traffic through the trans-Golgi network (TGN). Functions in close cooperation with the GGAs in the sorting of hydrolases to lysosomes.
PDB	1OM9
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Widely expressed. {ECO:0000269\|PubMed:12808037}.
Sequence	MDDDDFGGFEAAETFDGGSGETQTTSPAIPWAAFPAVSGVHLSPSSPEIVLDRDHSSSIG CLSSDAIISSPENTHAANSIVSQTIPKAQIQQSTHTHLDISLFPLGLTDEKSNGTIALVD DSEDPGANVSNIQLQQKISSLEIKLKVSEEEKQRIKQDVESLMEKHNVLEKGFLKEKEQE AISFQDRYKELQEKHKQELEDMRKAGHEALSIIVDEYKALLQSSVKQQVEAIEKQYISAI EKQAHKCEELLNAQHQRLLEMLDTEKELLKEKIKEALIQQSQEQKEILEKCLEEERQRNK EALVSAAKLEKEAVKDAVLKVVEEERKNLEKAHAEERELWKTEHAKDQEKVSQEIQKAIQ EQRKISQETVKAAIIEEQKRSEKAVEEAVKRTRDELIEYIKEQKRLDQVIRQRSLSSLEL FLSCAQKQLSALIATEPVDIE
Sequence length	441
Interactions	View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (38)
ALZHEIMER DISEASE	—	GWAS catalog	35694926	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	28196072, 29146897, 30573740	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	24388013	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	18821565	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GenCC	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	23535729, 23535733, 25751625, 27117709, 29059683, 31757997, 32139696, 32514122, 32887889, 34290314, 34594039, 37340002, 37380357, 38538606	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	23535729, 23535733, 23544013, 25751625, 27117709, 29058716, 29059683, 31757997, 32139696, 32514122, 32887889, 34290314, 34594039, 37340002, 38538606	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST DISEASE	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	30804561, 33909500, 37069358	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	35694926, 39046104	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL TREMOR	—	GWAS catalog	27797806	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	27117709, 29058716, 32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	38102678	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	37337107	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LARYNGEAL DISEASE	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHY	—	GWAS catalog	31220337	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	33627673, 37386247, 38382466	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	40205036	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HAND	—	GWAS catalog	28855172, 33055079	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	40205036	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	39503264	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	GWAS catalog	26284813	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	30019117	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL ALLERGIC RHINITIS	—	GWAS catalog	24388013	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	38317187	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	38162683	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRIPLE-NEGATIVE BREAST CANCER	—	GWAS catalog	24325915	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (12)
Acute pancreatitis	Pancreatitis	BEFREE	28984787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27459855	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	11765912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASCAT_DG	30804561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	30890645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperostosis Diffuse Idiopathic Skeletal	Diffuse idiopathic skeletal hyperostosis	Pubtator	37156767	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30890645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	26635082	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	20484596		★★★★★ ★☆☆☆☆ Found in Text Mining only
OSSIFICATION OF THE POSTERIOR LONGITUDINAL LIGAMENT OF SPINE	Ossification Of The Posterior Longitudinal Ligament Of Spine	GWASCAT_DG	25064007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	GWASCAT_DG	26284813		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus	Status Epilepticus	BEFREE	31270158		★★★★★ ★☆☆☆☆ Found in Text Mining only

CCDC91 (coiled-coil domain containing 91)

Bookmark This Gene