Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	8772
Gene name	Fas associated via death domain
Gene symbol	FADD
Synonyms (NCBI Gene)	GIG3IMD90MORT1
Chromosome	11
Chromosome location	11q13.3
Summary	The protein encoded by this gene is an adaptor molecule that interacts with various cell surface receptors and mediates cell apoptotic signals. Through its C-terminal death domain, this protein can be recruited by TNFRSF6/Fas-receptor, tumor necrosis fact

Show/Hide all (4)

SNP ID	Visualize variation	Clinical significance	Consequence
rs369869993	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs387906839	T>G	Pathogenic	Missense variant, coding sequence variant
rs863224871	AGCGAGC>-	Likely-pathogenic	Stop gained, coding sequence variant
rs1392069885	G>A	Likely-pathogenic	Missense variant, coding sequence variant

110

Show/Hide all (110)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000638	hsa-miR-146a-5p	Luciferase reporter assay	19965651
MIRT006848	hsa-miR-155-5p	GFP reporter assayImmunohistochemistryIn situ hybridizationLuciferase reporter assayMicroarrayqRT-PCRWestern blot	21706480
MIRT006848	hsa-miR-155-5p	GFP reporter assayImmunohistochemistryIn situ hybridizationLuciferase reporter assayMicroarrayqRT-PCRWestern blot	21706480
MIRT023826	hsa-miR-1-3p	Microarray	18668037
MIRT025869	hsa-miR-7-5p	Sequencing	20371350
MIRT046456	hsa-miR-15b-5p	CLASH	23622248
MIRT736414	hsa-miR-491-3p	qRT-PCRFlow cytometry	33679688
MIRT974914	hsa-miR-1178	CLIP-seq
MIRT974915	hsa-miR-1287	CLIP-seq
MIRT974916	hsa-miR-1288	CLIP-seq
MIRT974917	hsa-miR-28-5p	CLIP-seq
MIRT974918	hsa-miR-3135b	CLIP-seq
MIRT974919	hsa-miR-3139	CLIP-seq
MIRT974920	hsa-miR-3140-3p	CLIP-seq
MIRT974921	hsa-miR-3156-5p	CLIP-seq
MIRT974922	hsa-miR-3159	CLIP-seq
MIRT974923	hsa-miR-3169	CLIP-seq
MIRT974924	hsa-miR-320a	CLIP-seq
MIRT974925	hsa-miR-320b	CLIP-seq
MIRT974926	hsa-miR-320c	CLIP-seq
MIRT974927	hsa-miR-320d	CLIP-seq
MIRT974928	hsa-miR-3591-5p	CLIP-seq
MIRT974929	hsa-miR-3670	CLIP-seq
MIRT974930	hsa-miR-3681	CLIP-seq
MIRT974931	hsa-miR-382	CLIP-seq
MIRT974932	hsa-miR-4302	CLIP-seq
MIRT974933	hsa-miR-4429	CLIP-seq
MIRT974934	hsa-miR-4460	CLIP-seq
MIRT974935	hsa-miR-4462	CLIP-seq
MIRT974936	hsa-miR-4638-3p	CLIP-seq
MIRT974937	hsa-miR-4722-5p	CLIP-seq
MIRT974938	hsa-miR-4724-3p	CLIP-seq
MIRT974939	hsa-miR-4727-3p	CLIP-seq
MIRT974940	hsa-miR-4729	CLIP-seq
MIRT974941	hsa-miR-606	CLIP-seq
MIRT974942	hsa-miR-633	CLIP-seq
MIRT974943	hsa-miR-708	CLIP-seq
MIRT1988849	hsa-miR-1183	CLIP-seq
MIRT1988850	hsa-miR-128	CLIP-seq
MIRT1988851	hsa-miR-1343	CLIP-seq
MIRT1988852	hsa-miR-185	CLIP-seq
MIRT1988853	hsa-miR-1913	CLIP-seq
MIRT1988854	hsa-miR-193a-5p	CLIP-seq
MIRT1988855	hsa-miR-27a	CLIP-seq
MIRT1988856	hsa-miR-27b	CLIP-seq
MIRT1988857	hsa-miR-3074-5p	CLIP-seq
MIRT1988858	hsa-miR-3128	CLIP-seq
MIRT1988859	hsa-miR-323-5p	CLIP-seq
MIRT1988860	hsa-miR-324-3p	CLIP-seq
MIRT1988861	hsa-miR-3665	CLIP-seq
MIRT1988862	hsa-miR-3667-3p	CLIP-seq
MIRT1988863	hsa-miR-3688-3p	CLIP-seq
MIRT1988864	hsa-miR-3690	CLIP-seq
MIRT1988865	hsa-miR-370	CLIP-seq
MIRT1988866	hsa-miR-377	CLIP-seq
MIRT1988867	hsa-miR-378g	CLIP-seq
MIRT1988868	hsa-miR-3919	CLIP-seq
MIRT1988869	hsa-miR-3925-5p	CLIP-seq
MIRT1988870	hsa-miR-412	CLIP-seq
MIRT1988871	hsa-miR-4254	CLIP-seq
MIRT1988872	hsa-miR-4274	CLIP-seq
MIRT1988873	hsa-miR-4306	CLIP-seq
MIRT1988874	hsa-miR-4330	CLIP-seq
MIRT1988875	hsa-miR-4474-3p	CLIP-seq
MIRT1988876	hsa-miR-4519	CLIP-seq
MIRT1988877	hsa-miR-4524	CLIP-seq
MIRT1988878	hsa-miR-4527	CLIP-seq
MIRT1988879	hsa-miR-4644	CLIP-seq
MIRT1988880	hsa-miR-4645-5p	CLIP-seq
MIRT1988881	hsa-miR-4673	CLIP-seq
MIRT974938	hsa-miR-4724-3p	CLIP-seq
MIRT1988882	hsa-miR-4731-5p	CLIP-seq
MIRT1988883	hsa-miR-4738-3p	CLIP-seq
MIRT1988884	hsa-miR-4749-3p	CLIP-seq
MIRT1988885	hsa-miR-4756-3p	CLIP-seq
MIRT1988886	hsa-miR-512-3p	CLIP-seq
MIRT1988887	hsa-miR-512-5p	CLIP-seq
MIRT1988888	hsa-miR-513a-5p	CLIP-seq
MIRT1988889	hsa-miR-516a-3p	CLIP-seq
MIRT1988890	hsa-miR-548g	CLIP-seq
MIRT1988891	hsa-miR-589	CLIP-seq
MIRT1988850	hsa-miR-128	CLIP-seq
MIRT1988851	hsa-miR-1343	CLIP-seq
MIRT1988854	hsa-miR-193a-5p	CLIP-seq
MIRT1988855	hsa-miR-27a	CLIP-seq
MIRT1988856	hsa-miR-27b	CLIP-seq
MIRT2223236	hsa-miR-2861	CLIP-seq
MIRT2223237	hsa-miR-3065-3p	CLIP-seq
MIRT1988857	hsa-miR-3074-5p	CLIP-seq
MIRT2223238	hsa-miR-3160-3p	CLIP-seq
MIRT974928	hsa-miR-3591-5p	CLIP-seq
MIRT974929	hsa-miR-3670	CLIP-seq
MIRT974930	hsa-miR-3681	CLIP-seq
MIRT1988865	hsa-miR-370	CLIP-seq
MIRT2223239	hsa-miR-3921	CLIP-seq
MIRT1988870	hsa-miR-412	CLIP-seq
MIRT2223240	hsa-miR-4286	CLIP-seq
MIRT2223241	hsa-miR-4303	CLIP-seq
MIRT974934	hsa-miR-4460	CLIP-seq
MIRT2223242	hsa-miR-4487	CLIP-seq
MIRT2223243	hsa-miR-4653-5p	CLIP-seq
MIRT974939	hsa-miR-4727-3p	CLIP-seq
MIRT974940	hsa-miR-4729	CLIP-seq
MIRT1988882	hsa-miR-4731-5p	CLIP-seq
MIRT2223244	hsa-miR-4757-5p	CLIP-seq
MIRT1988886	hsa-miR-512-3p	CLIP-seq
MIRT1988887	hsa-miR-512-5p	CLIP-seq
MIRT1988888	hsa-miR-513a-5p	CLIP-seq
MIRT1988889	hsa-miR-516a-3p	CLIP-seq
MIRT2223245	hsa-miR-558	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
DEDD	Unknown	17193921
RUNX3	Activation	17956589

100

Show/Hide all (100)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0001822	Process	Kidney development	IEA
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	IEA
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	ISS
GO:0002020	Function	Protease binding	IEA
GO:0002020	Function	Protease binding	IPI	9208847, 21785459
GO:0002376	Process	Immune system process	IEA
GO:0002821	Process	Positive regulation of adaptive immune response	IEA
GO:0002821	Process	Positive regulation of adaptive immune response	ISS
GO:0005123	Function	Death receptor binding	IBA
GO:0005123	Function	Death receptor binding	IEA
GO:0005123	Function	Death receptor binding	TAS	7538907
GO:0005164	Function	Tumor necrosis factor receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	7536190, 7538907, 8681376, 9208847, 9343261, 10442631, 10880445, 11112409, 12702765, 12887920, 14612908, 15688372, 16127453, 16498403, 17047155, 17159907, 18328427, 18485876, 18846110, 19060883, 19118384, 19176810, 19524512, 19524513, 20103630, 20890306, 20935634, 21382479, 21458669
GO:0005737	Component	Cytoplasm	IDA	22510408
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	21785459
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	22510408
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IMP	22891283
GO:0007165	Process	Signal transduction	IEA
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IDA	9184224
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IDA	9184224, 24025841
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	TAS	7538907
GO:0009898	Component	Cytoplasmic side of plasma membrane	IC	8565075
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	8565075, 16762833
GO:0030674	Function	Protein-macromolecule adaptor activity	IEA
GO:0031264	Component	Death-inducing signaling complex	IDA	11101870, 21803845
GO:0031264	Component	Death-inducing signaling complex	IEA
GO:0031264	Component	Death-inducing signaling complex	TAS	18309324
GO:0031265	Component	CD95 death-inducing signaling complex	IBA
GO:0031265	Component	CD95 death-inducing signaling complex	IDA	20935634
GO:0031265	Component	CD95 death-inducing signaling complex	IEA
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	ISS
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	16127453
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	16127453
GO:0032813	Function	Tumor necrosis factor receptor superfamily binding	IPI	21109225
GO:0032991	Component	Protein-containing complex	IEA
GO:0033077	Process	T cell differentiation in thymus	IEA
GO:0033077	Process	T cell differentiation in thymus	ISS
GO:0033612	Function	Receptor serine/threonine kinase binding	IEA
GO:0035591	Function	Signaling adaptor activity	IEA
GO:0035877	Function	Death effector domain binding	IPI	11717445
GO:0036462	Process	TRAIL-activated apoptotic signaling pathway	IDA	21785459
GO:0042104	Process	Positive regulation of activated T cell proliferation	IEA
GO:0042104	Process	Positive regulation of activated T cell proliferation	ISS
GO:0042220	Process	Response to cocaine	IEA
GO:0042802	Function	Identical protein binding	IPI	7536190, 8681376, 25502805, 30561431, 31515488, 32296183
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043029	Process	T cell homeostasis	IEA
GO:0043029	Process	T cell homeostasis	ISS
GO:0043065	Process	Positive regulation of apoptotic process	IDA	11821383
GO:0043065	Process	Positive regulation of apoptotic process	IMP	20935634
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEP	12761501
GO:0044297	Component	Cell body	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045089	Process	Positive regulation of innate immune response	IBA
GO:0045651	Process	Positive regulation of macrophage differentiation	IMP	17047155
GO:0045862	Process	Positive regulation of proteolysis	IDA	18387192
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16127453
GO:0048148	Process	Behavioral response to cocaine	IEA
GO:0048535	Process	Lymph node development	IEA
GO:0048535	Process	Lymph node development	ISS
GO:0048536	Process	Spleen development	IEA
GO:0048536	Process	Spleen development	ISS
GO:0048538	Process	Thymus development	IEA
GO:0048538	Process	Thymus development	ISS
GO:0050778	Process	Positive regulation of immune response	IEA
GO:0051607	Process	Defense response to virus	IMP	21109225
GO:0060340	Process	Positive regulation of type I interferon-mediated signaling pathway	IMP	21109225
GO:0060544	Process	Regulation of necroptotic process	IEA
GO:0060546	Process	Negative regulation of necroptotic process	IEA
GO:0070236	Process	Negative regulation of activation-induced cell death of T cells	IEA
GO:0070236	Process	Negative regulation of activation-induced cell death of T cells	ISS
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0071550	Process	Death-inducing signaling complex assembly	IDA	24025841
GO:0089720	Function	Caspase binding	IBA
GO:0089720	Function	Caspase binding	IDA	24025841
GO:0089720	Function	Caspase binding	IPI	9343261
GO:0097049	Process	Motor neuron apoptotic process	IEA
GO:0097190	Process	Apoptotic signaling pathway	IDA	8565075, 11101870
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IBA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IDA	21785459
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IEA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IEA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IMP	16611992
GO:0097191	Process	Extrinsic apoptotic signaling pathway	TAS	18309324
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IEA
GO:0097342	Component	Ripoptosome	IDA	21737330
GO:0097527	Process	Necroptotic signaling pathway	IMP	11101870
GO:0098542	Process	Defense response to other organism	IEA
GO:1900119	Process	Positive regulation of execution phase of apoptosis	IEA
GO:2000454	Process	Positive regulation of CD8-positive, alpha-beta cytotoxic T cell extravasation	IEA
GO:2000454	Process	Positive regulation of CD8-positive, alpha-beta cytotoxic T cell extravasation	ISS
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IEA
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IEA
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IMP	21525013

MIM	HGNC	e!Ensembl
602457	3573	ENSG00000168040

Q13158

Protein name

FAS-associated death domain protein (FAS-associating death domain-containing protein) (Growth-inhibiting gene 3 protein) (Mediator of receptor induced toxicity)

Protein function

Apoptotic adapter molecule that recruits caspases CASP8 or CASP10 to the activated FAS/CD95 or TNFRSF1A/TNFR-1 receptors (PubMed:16762833, PubMed:19118384, PubMed:20935634, PubMed:23955153, PubMed:24025841, PubMed:7538907, PubMed:9184224). The r

PDB

1A1W , 1A1Z , 1E3Y , 1E41 , 2GF5 , 3EZQ , 3OQ9 , 6ACI , 7LXC , 8YBX , 8YD7 , 8YD8 , 8YNI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01335	DED	4 → 85	Death effector domain	Domain
PF00531	Death	98 → 181	Death domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in a wide variety of tissues, except for peripheral blood mononuclear leukocytes. {ECO:0000269|PubMed:7538907}.

Sequence

MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHT
ELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLK
VSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEV
QQARDLQNRSGAMSPMSWNSDASTSEAS

Sequence length

208

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
FADD-related immunodeficiency	Pathogenic; Likely pathogenic	rs863224871, rs387906839	RCV001795381 RCV001787029	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRANIOFACIAL ABNORMALITIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FADD-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 90 WITH ENCEPHALOPATHY, FUNCTIONAL HYPOSPLENIA, AND HEPATIC DYSFUNCTION	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULOAURICULAR SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULOOTODENTAL SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SENSORINEURAL HEARING LOSS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (134)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	28978109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	16109772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	19415536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28978109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	16740746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	39396083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	BEFREE	29282816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	35480868	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10817565	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	16951485	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune Lymphoproliferative Disorder	BEFREE	10200300, 21109225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune lymphoproliferative disorder	Pubtator	10200300, 33995372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome Type 2B	Autoimmune Lymphoproliferative Disorder	BEFREE	29911256, 30741924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	20942909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20446019, 31443698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16450001, 18840411, 24886289, 27013580, 27388253, 31443698	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	10477698, 21315423	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27013580	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	24886289	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37666920	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	17187659	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	27078887	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36138066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	37798313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	28978109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11891278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15601308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15490974, 19415536, 27622714, 29808797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27622714, 28061540, 33076720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital atresia of pulmonary artery	Congenital Atresia Of Pulmonary Artery	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital ocular coloboma (disorder)	Congenital ocular coloboma	BEFREE	17656375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31762289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	28320441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dental Diseases	Dental Diseases	CTD_human_DG	17656375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15972661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15972661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10982176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	16740746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diverticular Bleeding	Diverticular Bleeding	CTD_human_DG	30177863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diverticular Diseases	Diverticular Diseases	CTD_human_DG	30177863		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Encephalopathies	Epileptic encephalopathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	17187659	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	19728877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	22355661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	LHGDN	15601308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11420694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11420694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	16037822, 20942909, 23811124, 27255231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	26808319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	23974629	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	37798313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	18661484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	30367502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	LHGDN	15956881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	15078899	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Howell-Jolly Bodies	Howell-Jolly Bodies	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	11334117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	31300668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28320441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	15572586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kashin-Beck Disease	Kashin-Beck Disease	BEFREE	31762289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	22208968	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	26914121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11514566, 12506034, 35637951	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11739185, 37367830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	28978109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10025875, 16844082, 31067004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	33104018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12037669, 16258269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37864090	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19644848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	18268491, 27388253	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23358467, 23974629, 27764170	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	21315423	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	11605003, 9694158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	26808319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20446019, 31443698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	15601308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	15942670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15601308, 16109772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pharynx	Malignant Pharyngeal Neoplasm	BEFREE	27764170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11803475, 16437387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15601308, 29744288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11464214, 12037669, 19728877, 20446019, 28039268, 28848149, 29808797, 31569512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15601308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16450001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	11468180		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21493591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	19479204, 23974629, 35421271	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	21315423	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	12681357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	15677568	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	BEFREE	15942670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15121855, 15586236, 19415536, 19728877, 23001827, 27556297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	19176810	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30190126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculootodental syndrome	Oculootodental Syndrome	ORPHANET_DG	17656375		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oculootodental syndrome	Oculootodental Syndrome	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	31762289	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	14999771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28504421	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	14583775, 32504778	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	11805265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	29904933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	22789864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	27556297, 30805584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	28320441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11803475, 16437387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	17203870	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17203870	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	12681357, 16951485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	17911615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	12761581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10757027, 10817565, 16951485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	17643097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	CTD_human_DG	17656375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensory hearing loss	Hearing Loss	CTD_human_DG	17656375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	30551620	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	20040024, 25129245, 27764170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	17187659, 19728877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17026852, 23358467, 24278325, 26914121, 27764170, 32065407, 33227411, 33456497, 34423028	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	24278325, 26808319, 28304089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	20040024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29744288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12439910, 15991280	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15601308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomatognathic Diseases	Stomatognathic Diseases	CTD_human_DG	17656375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	17643097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35631261, 37093683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	30567904	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	15197583, 30567904	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only

FADD (Fas associated via death domain)