Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	2150
Gene name	F2R like trypsin receptor 1
Gene symbol	F2RL1
Synonyms (NCBI Gene)	GPR11PAR2
Chromosome	5
Chromosome location	5q13.3
Summary	This gene encodes a member of the G-protein coupled receptor 1 family of proteins. The encoded cell surface receptor is activated through proteolytic cleavage of its extracellular amino terminus, resulting in a new amino terminus that acts as a tethered l

458

Show/Hide all (458)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023577	hsa-miR-1-3p	Microarray	18668037
MIRT724017	hsa-miR-483-3p	HITS-CLIP	19536157
MIRT724016	hsa-miR-6747-3p	HITS-CLIP	19536157
MIRT724015	hsa-miR-1304-3p	HITS-CLIP	19536157
MIRT629097	hsa-miR-367-5p	HITS-CLIP	19536157
MIRT724014	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT724013	hsa-miR-4763-5p	HITS-CLIP	19536157
MIRT724012	hsa-miR-4297	HITS-CLIP	19536157
MIRT724011	hsa-miR-5581-5p	HITS-CLIP	19536157
MIRT629091	hsa-miR-6501-5p	HITS-CLIP	19536157
MIRT629090	hsa-miR-4423-5p	HITS-CLIP	19536157
MIRT724010	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT724008	hsa-miR-6894-3p	HITS-CLIP	19536157
MIRT724009	hsa-miR-6514-3p	HITS-CLIP	19536157
MIRT629089	hsa-miR-744-3p	HITS-CLIP	19536157
MIRT724007	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT724006	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT359188	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT359185	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT359191	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT359189	hsa-miR-4495	HITS-CLIP	21572407
MIRT359186	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT509885	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT359183	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT685267	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT685266	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT685265	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT685264	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT685263	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT685262	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT685261	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT685260	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT685259	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT685258	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT685257	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT685256	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT685255	hsa-miR-302e	HITS-CLIP	23313552
MIRT685254	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT685253	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT685252	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT685251	hsa-miR-520b	HITS-CLIP	23313552
MIRT685250	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT685249	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT685248	hsa-miR-520e	HITS-CLIP	23313552
MIRT685247	hsa-miR-8485	HITS-CLIP	23313552
MIRT685246	hsa-miR-329-3p	HITS-CLIP	23313552
MIRT685245	hsa-miR-362-3p	HITS-CLIP	23313552
MIRT685244	hsa-miR-603	HITS-CLIP	23313552
MIRT523840	hsa-miR-6813-3p	HITS-CLIP	23313552
MIRT685243	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT685242	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT685241	hsa-miR-520h	HITS-CLIP	23313552
MIRT685240	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT685239	hsa-miR-212-5p	HITS-CLIP	23313552
MIRT685238	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT685237	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT685236	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT685235	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT685234	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT685233	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT685232	hsa-miR-4757-5p	HITS-CLIP	23313552
MIRT685231	hsa-miR-6744-3p	HITS-CLIP	23313552
MIRT685230	hsa-miR-3941	HITS-CLIP	23313552
MIRT685229	hsa-miR-4672	HITS-CLIP	23313552
MIRT685228	hsa-miR-466	HITS-CLIP	23313552
MIRT685227	hsa-miR-6878-3p	HITS-CLIP	23313552
MIRT685226	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT685267	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT685266	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT685265	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT685264	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT685263	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT685262	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT685261	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT685260	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT685259	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT685258	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT685257	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT685256	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT685255	hsa-miR-302e	HITS-CLIP	23313552
MIRT685254	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT685253	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT685252	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT685251	hsa-miR-520b	HITS-CLIP	23313552
MIRT685250	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT685249	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT685248	hsa-miR-520e	HITS-CLIP	23313552
MIRT685247	hsa-miR-8485	HITS-CLIP	23313552
MIRT685246	hsa-miR-329-3p	HITS-CLIP	23313552
MIRT685245	hsa-miR-362-3p	HITS-CLIP	23313552
MIRT685244	hsa-miR-603	HITS-CLIP	23313552
MIRT523840	hsa-miR-6813-3p	HITS-CLIP	23313552
MIRT685243	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT685242	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT685241	hsa-miR-520h	HITS-CLIP	23313552
MIRT685240	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT685239	hsa-miR-212-5p	HITS-CLIP	23313552
MIRT685238	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT685237	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT685236	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT685235	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT685234	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT685233	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT685232	hsa-miR-4757-5p	HITS-CLIP	23313552
MIRT685231	hsa-miR-6744-3p	HITS-CLIP	23313552
MIRT685230	hsa-miR-3941	HITS-CLIP	23313552
MIRT685229	hsa-miR-4672	HITS-CLIP	23313552
MIRT685228	hsa-miR-466	HITS-CLIP	23313552
MIRT685227	hsa-miR-6878-3p	HITS-CLIP	23313552
MIRT685226	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT629105	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT629104	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT629103	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT629102	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT629101	hsa-miR-3666	HITS-CLIP	23824327
MIRT629100	hsa-miR-4295	HITS-CLIP	23824327
MIRT629099	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT629098	hsa-miR-1266-3p	HITS-CLIP	23824327
MIRT629097	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT629096	hsa-miR-3135b	HITS-CLIP	23824327
MIRT629095	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT629094	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT629093	hsa-miR-3652	HITS-CLIP	23824327
MIRT629092	hsa-miR-4430	HITS-CLIP	23824327
MIRT629091	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT629090	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT629089	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT359188	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT359185	hsa-miR-410-3p	PAR-CLIP	20371350
MIRT359191	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT359189	hsa-miR-4495	PAR-CLIP	20371350
MIRT359186	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT509886	hsa-miR-205-3p	PAR-CLIP	20371350
MIRT509885	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT359183	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT523840	hsa-miR-6813-3p	PAR-CLIP	23446348
MIRT523839	hsa-miR-1224-3p	PAR-CLIP	23446348
MIRT523838	hsa-miR-6790-3p	PAR-CLIP	23446348
MIRT523837	hsa-miR-6821-3p	PAR-CLIP	23446348
MIRT523836	hsa-miR-640	PAR-CLIP	23446348
MIRT359188	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT359185	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT359191	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT359189	hsa-miR-4495	PAR-CLIP	23446348
MIRT359186	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT509886	hsa-miR-205-3p	PAR-CLIP	23446348
MIRT509885	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT359183	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT724017	hsa-miR-483-3p	HITS-CLIP	19536157
MIRT724016	hsa-miR-6747-3p	HITS-CLIP	19536157
MIRT724015	hsa-miR-1304-3p	HITS-CLIP	19536157
MIRT629097	hsa-miR-367-5p	HITS-CLIP	19536157
MIRT724014	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT724013	hsa-miR-4763-5p	HITS-CLIP	19536157
MIRT724012	hsa-miR-4297	HITS-CLIP	19536157
MIRT724011	hsa-miR-5581-5p	HITS-CLIP	19536157
MIRT629091	hsa-miR-6501-5p	HITS-CLIP	19536157
MIRT629090	hsa-miR-4423-5p	HITS-CLIP	19536157
MIRT724010	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT724008	hsa-miR-6894-3p	HITS-CLIP	19536157
MIRT724009	hsa-miR-6514-3p	HITS-CLIP	19536157
MIRT629089	hsa-miR-744-3p	HITS-CLIP	19536157
MIRT724007	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT724006	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT359188	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT359185	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT359191	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT359189	hsa-miR-4495	HITS-CLIP	21572407
MIRT359186	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT509885	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT359183	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT685267	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT685266	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT685265	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT685264	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT685263	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT685262	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT685261	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT685260	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT685259	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT685258	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT685257	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT685256	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT685255	hsa-miR-302e	HITS-CLIP	23313552
MIRT685254	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT685253	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT685252	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT685251	hsa-miR-520b	HITS-CLIP	23313552
MIRT685250	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT685249	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT685248	hsa-miR-520e	HITS-CLIP	23313552
MIRT685247	hsa-miR-8485	HITS-CLIP	23313552
MIRT685246	hsa-miR-329-3p	HITS-CLIP	23313552
MIRT685245	hsa-miR-362-3p	HITS-CLIP	23313552
MIRT685244	hsa-miR-603	HITS-CLIP	23313552
MIRT523840	hsa-miR-6813-3p	HITS-CLIP	23313552
MIRT685243	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT685242	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT685241	hsa-miR-520h	HITS-CLIP	23313552
MIRT685240	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT685239	hsa-miR-212-5p	HITS-CLIP	23313552
MIRT685238	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT685237	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT685236	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT685235	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT685234	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT685233	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT685232	hsa-miR-4757-5p	HITS-CLIP	23313552
MIRT685231	hsa-miR-6744-3p	HITS-CLIP	23313552
MIRT685230	hsa-miR-3941	HITS-CLIP	23313552
MIRT685229	hsa-miR-4672	HITS-CLIP	23313552
MIRT685228	hsa-miR-466	HITS-CLIP	23313552
MIRT685227	hsa-miR-6878-3p	HITS-CLIP	23313552
MIRT685226	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT685267	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT685266	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT685265	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT685264	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT685263	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT685262	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT685261	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT685260	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT685259	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT685258	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT685257	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT685256	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT685255	hsa-miR-302e	HITS-CLIP	23313552
MIRT685254	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT685253	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT685252	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT685251	hsa-miR-520b	HITS-CLIP	23313552
MIRT685250	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT685249	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT685248	hsa-miR-520e	HITS-CLIP	23313552
MIRT685247	hsa-miR-8485	HITS-CLIP	23313552
MIRT685246	hsa-miR-329-3p	HITS-CLIP	23313552
MIRT685245	hsa-miR-362-3p	HITS-CLIP	23313552
MIRT685244	hsa-miR-603	HITS-CLIP	23313552
MIRT523840	hsa-miR-6813-3p	HITS-CLIP	23313552
MIRT685243	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT685242	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT685241	hsa-miR-520h	HITS-CLIP	23313552
MIRT685240	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT685239	hsa-miR-212-5p	HITS-CLIP	23313552
MIRT685238	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT685237	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT685236	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT685235	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT685234	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT685233	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT685232	hsa-miR-4757-5p	HITS-CLIP	23313552
MIRT685231	hsa-miR-6744-3p	HITS-CLIP	23313552
MIRT685230	hsa-miR-3941	HITS-CLIP	23313552
MIRT685229	hsa-miR-4672	HITS-CLIP	23313552
MIRT685228	hsa-miR-466	HITS-CLIP	23313552
MIRT685227	hsa-miR-6878-3p	HITS-CLIP	23313552
MIRT685226	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT629105	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT629104	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT629103	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT629102	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT629101	hsa-miR-3666	HITS-CLIP	23824327
MIRT629100	hsa-miR-4295	HITS-CLIP	23824327
MIRT629099	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT629098	hsa-miR-1266-3p	HITS-CLIP	23824327
MIRT629097	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT629096	hsa-miR-3135b	HITS-CLIP	23824327
MIRT629095	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT629094	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT629093	hsa-miR-3652	HITS-CLIP	23824327
MIRT629092	hsa-miR-4430	HITS-CLIP	23824327
MIRT629091	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT629090	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT629089	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT359188	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT359185	hsa-miR-410-3p	PAR-CLIP	20371350
MIRT359191	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT359189	hsa-miR-4495	PAR-CLIP	20371350
MIRT359186	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT509886	hsa-miR-205-3p	PAR-CLIP	20371350
MIRT509885	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT359183	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT523840	hsa-miR-6813-3p	PAR-CLIP	23446348
MIRT523839	hsa-miR-1224-3p	PAR-CLIP	23446348
MIRT523838	hsa-miR-6790-3p	PAR-CLIP	23446348
MIRT523837	hsa-miR-6821-3p	PAR-CLIP	23446348
MIRT523836	hsa-miR-640	PAR-CLIP	23446348
MIRT359188	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT359185	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT359191	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT359189	hsa-miR-4495	PAR-CLIP	23446348
MIRT359186	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT509886	hsa-miR-205-3p	PAR-CLIP	23446348
MIRT509885	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT359183	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT974373	hsa-miR-103a	CLIP-seq
MIRT974374	hsa-miR-105	CLIP-seq
MIRT974375	hsa-miR-106a	CLIP-seq
MIRT974376	hsa-miR-106b	CLIP-seq
MIRT974377	hsa-miR-107	CLIP-seq
MIRT974378	hsa-miR-1179	CLIP-seq
MIRT974379	hsa-miR-1200	CLIP-seq
MIRT974380	hsa-miR-1207-3p	CLIP-seq
MIRT974381	hsa-miR-122	CLIP-seq
MIRT974382	hsa-miR-1228	CLIP-seq
MIRT974383	hsa-miR-1253	CLIP-seq
MIRT974384	hsa-miR-1307	CLIP-seq
MIRT974385	hsa-miR-140-3p	CLIP-seq
MIRT974386	hsa-miR-142-5p	CLIP-seq
MIRT974387	hsa-miR-143	CLIP-seq
MIRT974388	hsa-miR-15a	CLIP-seq
MIRT974389	hsa-miR-15b	CLIP-seq
MIRT974390	hsa-miR-16	CLIP-seq
MIRT974391	hsa-miR-17	CLIP-seq
MIRT974392	hsa-miR-195	CLIP-seq
MIRT974393	hsa-miR-20a	CLIP-seq
MIRT974394	hsa-miR-20b	CLIP-seq
MIRT974395	hsa-miR-216b	CLIP-seq
MIRT974396	hsa-miR-224	CLIP-seq
MIRT974397	hsa-miR-299-3p	CLIP-seq
MIRT974398	hsa-miR-3145-5p	CLIP-seq
MIRT974399	hsa-miR-3149	CLIP-seq
MIRT974400	hsa-miR-3174	CLIP-seq
MIRT974401	hsa-miR-320e	CLIP-seq
MIRT974402	hsa-miR-340	CLIP-seq
MIRT974403	hsa-miR-3591-3p	CLIP-seq
MIRT974404	hsa-miR-3609	CLIP-seq
MIRT974405	hsa-miR-3665	CLIP-seq
MIRT974406	hsa-miR-3688-5p	CLIP-seq
MIRT974407	hsa-miR-3691-3p	CLIP-seq
MIRT974408	hsa-miR-374a	CLIP-seq
MIRT974409	hsa-miR-374b	CLIP-seq
MIRT974410	hsa-miR-377	CLIP-seq
MIRT974411	hsa-miR-410	CLIP-seq
MIRT974412	hsa-miR-411	CLIP-seq
MIRT974413	hsa-miR-412	CLIP-seq
MIRT974414	hsa-miR-424	CLIP-seq
MIRT974415	hsa-miR-4251	CLIP-seq
MIRT974416	hsa-miR-4263	CLIP-seq
MIRT974417	hsa-miR-4282	CLIP-seq
MIRT974418	hsa-miR-4284	CLIP-seq
MIRT974419	hsa-miR-4310	CLIP-seq
MIRT974420	hsa-miR-4314	CLIP-seq
MIRT974421	hsa-miR-4324	CLIP-seq
MIRT974422	hsa-miR-4328	CLIP-seq
MIRT974423	hsa-miR-4424	CLIP-seq
MIRT974424	hsa-miR-4464	CLIP-seq
MIRT974425	hsa-miR-4470	CLIP-seq
MIRT974426	hsa-miR-4491	CLIP-seq
MIRT974427	hsa-miR-4493	CLIP-seq
MIRT974428	hsa-miR-4638-5p	CLIP-seq
MIRT974429	hsa-miR-4657	CLIP-seq
MIRT974430	hsa-miR-4666-3p	CLIP-seq
MIRT974431	hsa-miR-4666-5p	CLIP-seq
MIRT974432	hsa-miR-4667-5p	CLIP-seq
MIRT974433	hsa-miR-4682	CLIP-seq
MIRT974434	hsa-miR-4694-3p	CLIP-seq
MIRT974435	hsa-miR-4699-3p	CLIP-seq
MIRT974436	hsa-miR-4700-5p	CLIP-seq
MIRT974437	hsa-miR-4710	CLIP-seq
MIRT974438	hsa-miR-4719	CLIP-seq
MIRT974439	hsa-miR-4748	CLIP-seq
MIRT974440	hsa-miR-4762-5p	CLIP-seq
MIRT974441	hsa-miR-4770	CLIP-seq
MIRT974442	hsa-miR-4772-3p	CLIP-seq
MIRT974443	hsa-miR-4775	CLIP-seq
MIRT974444	hsa-miR-4786-5p	CLIP-seq
MIRT974445	hsa-miR-4792	CLIP-seq
MIRT974446	hsa-miR-4796-3p	CLIP-seq
MIRT974447	hsa-miR-497	CLIP-seq
MIRT974448	hsa-miR-508-5p	CLIP-seq
MIRT974449	hsa-miR-519d	CLIP-seq
MIRT974450	hsa-miR-544b	CLIP-seq
MIRT974451	hsa-miR-548ah	CLIP-seq
MIRT974452	hsa-miR-548n	CLIP-seq
MIRT974453	hsa-miR-548t	CLIP-seq
MIRT974454	hsa-miR-568	CLIP-seq
MIRT974455	hsa-miR-590-3p	CLIP-seq
MIRT974456	hsa-miR-615-5p	CLIP-seq
MIRT974457	hsa-miR-627	CLIP-seq
MIRT974458	hsa-miR-637	CLIP-seq
MIRT974459	hsa-miR-657	CLIP-seq
MIRT974460	hsa-miR-659	CLIP-seq
MIRT974461	hsa-miR-671-5p	CLIP-seq
MIRT974462	hsa-miR-769-5p	CLIP-seq
MIRT974463	hsa-miR-924	CLIP-seq
MIRT974464	hsa-miR-93	CLIP-seq
MIRT974465	hsa-miR-934	CLIP-seq
MIRT974466	hsa-miR-944	CLIP-seq
MIRT974379	hsa-miR-1200	CLIP-seq
MIRT974381	hsa-miR-122	CLIP-seq
MIRT1988697	hsa-miR-1267	CLIP-seq
MIRT1988698	hsa-miR-2053	CLIP-seq
MIRT974396	hsa-miR-224	CLIP-seq
MIRT1988699	hsa-miR-3182	CLIP-seq
MIRT974401	hsa-miR-320e	CLIP-seq
MIRT1988700	hsa-miR-3616-3p	CLIP-seq
MIRT1988701	hsa-miR-3921	CLIP-seq
MIRT974420	hsa-miR-4314	CLIP-seq
MIRT974421	hsa-miR-4324	CLIP-seq
MIRT974422	hsa-miR-4328	CLIP-seq
MIRT1988702	hsa-miR-4512	CLIP-seq
MIRT1988703	hsa-miR-4635	CLIP-seq
MIRT1988704	hsa-miR-4649-3p	CLIP-seq
MIRT1988705	hsa-miR-4652-3p	CLIP-seq
MIRT1988706	hsa-miR-4653-5p	CLIP-seq
MIRT974430	hsa-miR-4666-3p	CLIP-seq
MIRT974432	hsa-miR-4667-5p	CLIP-seq
MIRT974433	hsa-miR-4682	CLIP-seq
MIRT974436	hsa-miR-4700-5p	CLIP-seq
MIRT974438	hsa-miR-4719	CLIP-seq
MIRT1988707	hsa-miR-4721	CLIP-seq
MIRT1988708	hsa-miR-4766-5p	CLIP-seq
MIRT974443	hsa-miR-4775	CLIP-seq
MIRT1988709	hsa-miR-494	CLIP-seq
MIRT1988710	hsa-miR-520d-5p	CLIP-seq
MIRT1988711	hsa-miR-524-5p	CLIP-seq
MIRT974450	hsa-miR-544b	CLIP-seq
MIRT974452	hsa-miR-548n	CLIP-seq
MIRT974453	hsa-miR-548t	CLIP-seq
MIRT1988712	hsa-miR-550a	CLIP-seq
MIRT1988713	hsa-miR-569	CLIP-seq
MIRT1988714	hsa-miR-582-3p	CLIP-seq
MIRT974456	hsa-miR-615-5p	CLIP-seq
MIRT974458	hsa-miR-637	CLIP-seq
MIRT974460	hsa-miR-659	CLIP-seq
MIRT974381	hsa-miR-122	CLIP-seq
MIRT2223120	hsa-miR-300	CLIP-seq
MIRT974401	hsa-miR-320e	CLIP-seq
MIRT2223121	hsa-miR-381	CLIP-seq
MIRT2223122	hsa-miR-4420	CLIP-seq
MIRT974430	hsa-miR-4666-3p	CLIP-seq
MIRT2223123	hsa-miR-4789-5p	CLIP-seq
MIRT974401	hsa-miR-320e	CLIP-seq
MIRT2387595	hsa-miR-4528	CLIP-seq
MIRT2387596	hsa-miR-4803	CLIP-seq
MIRT2442146	hsa-miR-1291	CLIP-seq
MIRT2442147	hsa-miR-146b-3p	CLIP-seq
MIRT2442148	hsa-miR-3670	CLIP-seq
MIRT2442149	hsa-miR-4303	CLIP-seq
MIRT2442150	hsa-miR-622	CLIP-seq
MIRT2449025	hsa-miR-1305	CLIP-seq
MIRT2449026	hsa-miR-3613-3p	CLIP-seq
MIRT2449027	hsa-miR-607	CLIP-seq
MIRT974380	hsa-miR-1207-3p	CLIP-seq
MIRT974381	hsa-miR-122	CLIP-seq
MIRT974383	hsa-miR-1253	CLIP-seq
MIRT974384	hsa-miR-1307	CLIP-seq
MIRT974401	hsa-miR-320e	CLIP-seq
MIRT974411	hsa-miR-410	CLIP-seq
MIRT974415	hsa-miR-4251	CLIP-seq
MIRT974428	hsa-miR-4638-5p	CLIP-seq
MIRT974380	hsa-miR-1207-3p	CLIP-seq
MIRT974381	hsa-miR-122	CLIP-seq
MIRT974383	hsa-miR-1253	CLIP-seq
MIRT974401	hsa-miR-320e	CLIP-seq
MIRT974411	hsa-miR-410	CLIP-seq
MIRT974415	hsa-miR-4251	CLIP-seq

107

Show/Hide all (107)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001648	Function	Proteinase-activated receptor activity	IEA
GO:0001965	Function	G-protein alpha-subunit binding	IEA
GO:0001965	Function	G-protein alpha-subunit binding	ISS
GO:0002020	Function	Protease binding	IPI	18434511
GO:0002286	Process	T cell activation involved in immune response	IEA
GO:0002286	Process	T cell activation involved in immune response	ISS
GO:0002376	Process	Immune system process	IEA
GO:0002690	Process	Positive regulation of leukocyte chemotaxis	IDA	17991872
GO:0002720	Process	Positive regulation of cytokine production involved in immune response	IDA	11441110
GO:0003104	Process	Positive regulation of glomerular filtration	IEA
GO:0003104	Process	Positive regulation of glomerular filtration	ISS
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IMP	18622013, 28445455
GO:0004930	Function	G protein-coupled receptor activity	ISS
GO:0004930	Function	G protein-coupled receptor activity	TAS	7556175
GO:0005102	Function	Signaling receptor binding	TAS	8615752
GO:0005515	Function	Protein binding	IPI	10725339, 15708858, 16410250, 16959886, 17693410, 20826780, 21219331, 28298427
GO:0005769	Component	Early endosome	IDA	22547407
GO:0005794	Component	Golgi apparatus	TAS	8615752
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	17848177, 22547407, 28445455
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006954	Process	Inflammatory response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IMP	28445455
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	7556175
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IDA	10725339
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	ISS
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	TAS	8615752
GO:0007596	Process	Blood coagulation	IEA
GO:0010804	Process	Negative regulation of tumor necrosis factor-mediated signaling pathway	IDA	19781631
GO:0015057	Function	Thrombin-activated receptor activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0030193	Process	Regulation of blood coagulation	IDA	17848177
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030335	Process	Positive regulation of cell migration	ISS
GO:0030836	Process	Positive regulation of actin filament depolymerization	IDA	17500066
GO:0031143	Component	Pseudopodium	IEA
GO:0031143	Component	Pseudopodium	ISS
GO:0031274	Process	Positive regulation of pseudopodium assembly	IEA
GO:0031274	Process	Positive regulation of pseudopodium assembly	ISS
GO:0031681	Function	G-protein beta-subunit binding	IEA
GO:0031681	Function	G-protein beta-subunit binding	ISS
GO:0032682	Process	Negative regulation of chemokine production	IDA	19865078
GO:0032722	Process	Positive regulation of chemokine production	IDA	19494303, 21501162
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	ISS
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IDA	15155775
GO:0032733	Process	Positive regulation of interleukin-10 production	IDA	18453611
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	11447194, 15155775
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	15155775, 17404307, 18622013, 19865078
GO:0032930	Process	Positive regulation of superoxide anion generation	IDA	11714832
GO:0034137	Process	Positive regulation of toll-like receptor 2 signaling pathway	IMP	19865078
GO:0034140	Process	Negative regulation of toll-like receptor 3 signaling pathway	IMP	19865078
GO:0034141	Process	Positive regulation of toll-like receptor 3 signaling pathway	IMP	19865078
GO:0034145	Process	Positive regulation of toll-like receptor 4 signaling pathway	IDA	18622013
GO:0035025	Process	Positive regulation of Rho protein signal transduction	IBA
GO:0035025	Process	Positive regulation of Rho protein signal transduction	IEA
GO:0035025	Process	Positive regulation of Rho protein signal transduction	IMP	20826780
GO:0035025	Process	Positive regulation of Rho protein signal transduction	ISS
GO:0038023	Function	Signaling receptor activity	TAS	8615752
GO:0042119	Process	Neutrophil activation	IDA	15155775
GO:0042311	Process	Vasodilation	IEA
GO:0042311	Process	Vasodilation	IEA
GO:0042311	Process	Vasodilation	ISS
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	IDA	18453611
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	11413129
GO:0043311	Process	Positive regulation of eosinophil degranulation	IDA	11714832
GO:0043547	Process	Positive regulation of GTPase activity	IMP	23202369
GO:0045087	Process	Innate immune response	IEA
GO:0045217	Process	Cell-cell junction maintenance	IMP	23202369
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16410250
GO:0046328	Process	Regulation of JNK cascade	IDA	16410250
GO:0046329	Process	Negative regulation of JNK cascade	IDA	19781631
GO:0046330	Process	Positive regulation of JNK cascade	IDA	11413129
GO:0046676	Process	Negative regulation of insulin secretion	IEA
GO:0050900	Process	Leukocyte migration	IDA	15155775
GO:0050921	Process	Positive regulation of chemotaxis	IEA
GO:0050921	Process	Positive regulation of chemotaxis	ISS
GO:0050927	Process	Positive regulation of positive chemotaxis	IDA	17991872
GO:0051607	Process	Defense response to virus	IDA	18453611, 19494303
GO:0051607	Process	Defense response to virus	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0060100	Process	Positive regulation of phagocytosis, engulfment	IDA	21501162
GO:0061028	Process	Establishment of endothelial barrier	IDA	20826780
GO:0065008	Process	Regulation of biological quality	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	10725339
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	ISS
GO:0070493	Process	Thrombin-activated receptor signaling pathway	IEA
GO:0070661	Process	Leukocyte proliferation	IEA
GO:0070661	Process	Leukocyte proliferation	ISS
GO:0070963	Process	Positive regulation of neutrophil mediated killing of gram-negative bacterium	IDA	21501162
GO:0097029	Process	Mature conventional dendritic cell differentiation	IDA	16478888
GO:0097029	Process	Mature conventional dendritic cell differentiation	IEA
GO:0097029	Process	Mature conventional dendritic cell differentiation	ISS
GO:1900135	Process	Positive regulation of renin secretion into blood stream	IEA
GO:1900135	Process	Positive regulation of renin secretion into blood stream	ISS
GO:2000341	Process	Regulation of chemokine (C-X-C motif) ligand 2 production	IDA	21501162

MIM	HGNC	e!Ensembl
600933	3538	ENSG00000164251

P55085

Protein name

Proteinase-activated receptor 2 (PAR-2) (Coagulation factor II receptor-like 1) (G-protein coupled receptor 11) (Thrombin receptor-like 1) [Cleaved into: Proteinase-activated receptor 2, alternate cleaved 1; Proteinase-activated receptor 2, alternate clea

Protein function

Receptor for trypsin and trypsin-like enzymes coupled to G proteins (PubMed:28445455). Its function is mediated through the activation of several signaling pathways including phospholipase C (PLC), intracellular calcium, mitogen-activated protei

PDB

5NDD , 5NDZ , 5NJ6

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	92 → 344	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed in tissues with especially high levels in pancreas, liver, kidney, small intestine, and colon (PubMed:7556175, PubMed:8615752). Moderate expression is detected in many organs, but none in brain or skeletal muscle (PubM

Sequence

MRSPSAAWLLGAAILLAASLSCSGTIQGTNRSSKGRSLIGKVDGTSHVTGKGVTVETVFS
VDEFSASVLTGKLTTVFLPIVYTIVFVVGLPSNGMALWVFLFRTKKKHPAVIYMANLALA
DLLSVIWFPLKIAYHIHGNNWIYGEALCNVLIGFFYGNMYCSILFMTCLSVQRYWVIVNP
MGHSRKKANIAIGISLAIWLLILLVTIPLYVVKQTIFIPALNITTCHDVLPEQLLVGDMF
NYFLSLAIGVFLFPAFLTASAYVLMIRMLRSSAMDENSEKKRKRAIKLIVTVLAMYLICF
TPSNLLLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHDFRDHAKNALL
CRSVRTVKQMQVSLTSKKHSRKSSSYSSSSTTVKTSY

Sequence length

397

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROENTERITIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRURITUS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (254)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acne	Acne	BEFREE	20697725, 25880702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	18802482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	14583448, 18757438, 19263271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	12548614, 30321617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	29165389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	17727088, 22391066, 27423452, 28426164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	25982926	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease	Alzheimer disease	Pubtator	32858090	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27248167, 28842394, 29165389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	18802482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	20131237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	17255532, 28220880, 28959204, 29599135, 29700120, 31756174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	17195212, 17328048, 17347265, 19247167, 28835277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	17328048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	33763056	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17328048, 20131259, 24914212, 33763056, 37814309	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	22294633	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	22294633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10641562, 12391252, 12589358, 16195539, 18077203, 24551046, 26658828, 27423452, 28317204, 28940559, 29911993, 30335499, 31168305, 31430011		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	11704532	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	12754192		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	18077203, 26658828	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	17255532, 28220880, 28959204, 29599135, 29700120, 31756174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	31756174	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30874892		★★★★★ ★☆☆☆☆ Found in Text Mining only
ATRICHIA WITH PAPULAR LESIONS	Atrichia With Papular Lesions	BEFREE	18802482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	26089202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	38139455	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	20623639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bile duct carcinoma	Bile duct carcinoma	BEFREE	20740367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	23131707, 34235728	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16397244, 16925462, 17936340, 18757438, 21318602, 21799402, 23287882, 24177339, 25173751, 25386994, 28522609, 29743547, 29870887, 30008831, 30129687, 30172372 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	14717972, 15489220, 16925462, 17470200, 19543320, 21318602, 24568471, 26244666, 28522609	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchial Diseases	Bronchial disease	Pubtator	24551046	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	16867018, 22770587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchitis Chronic	Bronchitis	Pubtator	11828045	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	LHGDN	15879299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17962194	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21488197, 21907696, 23991105, 40243559	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	19242518	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34199695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24138209, 30321617, 31572459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	28148395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33765016	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28101054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	18031579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	17936340, 18937843, 30093972, 30700181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	17936340, 30093972, 30700181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	20198321	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	20740367, 22892662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	24042113	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28025140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	18077203, 29980681		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Pain	Chronic pain	Pubtator	38139455	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	20530726, 26564991, 28146220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	22647427	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	24042113	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	28146220	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	30973971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	17581194, 30973971		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	17347265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	19184329, 28323866, 30237580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11883712, 14511767, 15010475, 21152870, 23170789, 23233043, 23991105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	15010475, 18949403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23170789, 24887481, 26354435, 30841957, 31598400, 31733286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11531266, 15010475, 20056842, 21625939, 21907696, 23233043, 23616010, 23991105, 23991686, 26354435, 37972702, 40243559	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	22892662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	24312345, 29843086, 30874892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17001320, 25773677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	15113859, 31756174	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	17581194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	18832729	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	11804840, 30655278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	19675284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	17195212, 17328048, 18031579, 19264156, 21682866, 21905006, 22294633, 28464560, 28835277, 29875735, 31841119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	15905579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	LHGDN	15905579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	LHGDN	14519665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	15654951, 29458120, 30287285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	15654951	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	12867500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	15654951, 23465358, 28191683, 28238749, 28586781, 28614190, 29458120, 30093649, 30287285, 30471839, 30972831, 31292344, 31487753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	15654951, 29458120, 30972831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	26564991, 31371788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	35806251	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	26564991, 31371788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	29118913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	26564991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	27283743, 29118913, 30672316, 30814628, 31666446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	29224812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Duodenitis	Duodenitis	Pubtator	36264979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyspepsia	Dysphasia	Pubtator	36264979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	15654951, 23465358, 28191683, 28238749, 28586781, 28614190, 29458120, 30093649, 30287285, 30471839, 30972831, 31292344, 31487753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	17203172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	21640344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	21640344	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	22672593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	29348584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	27906434, 28943918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	25297082	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	27906434, 28943918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	27906434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	20926011	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25297082	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	24495782, 27613872, 28245465, 28710422, 28883694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	28245472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroenteritis	Gastroenteritis	CTD_human_DG	12682265		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	27512850, 29672302	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	19263271, 20588261, 25265427, 26233549, 27512850, 29672302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	28169521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	24146905	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	20462964, 22497886, 24670244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24670244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	20462964, 24670244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19958818, 24670244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24670244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	28245472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	LHGDN	16478888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	20189717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	35269499	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	24312345, 29843086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	19543320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Histiocytosis haematophagic	Histiocytosis Haematophagic	BEFREE	23526486, 25912757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperalgesia	Hyperalgesia	Pubtator	25880199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	30045016	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	20131259	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	11886502	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	22461388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	20971733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	23131707	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	22461388		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	20131076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory abnormality of the eye	Inflammatory abnormality of the eye	BEFREE	16951492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	11804840, 19184329, 20848487, 31733286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	11804840, 21072196	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	15654951, 29458120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	35806251	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	35269499	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	20198321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	17304351, 26446924, 33750831	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	18363639, 23958521, 30012612, 30420896, 30446929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	37001853, 37108600	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	23283995	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30672316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24378410, 27258612	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	20578818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22940775, 24853422, 27473374, 29246306, 29563756, 30080656, 31768188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	34199695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	22940775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	30219079, 30655278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	10720740, 9328171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	30321617, 37395651	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	38172304	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28883515, 31666446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	34199695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	19958818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16397244, 16925462, 17936340, 18757438, 21318602, 21799402, 23287882, 24177339, 25173751, 25386994, 28522609, 29743547, 29870887, 30008831, 30129687, 30172372 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	27906434, 28943918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24138209, 30321617, 31572459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	17761706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	12527925, 15138580, 16525644, 17935125, 22088471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15537383, 19170048, 20623639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17517084, 22941376, 28491140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12527925, 16925462, 17373694, 17517084, 17761706, 21799402, 23055487, 23921961, 25773677, 25912757, 26354435, 27615543, 27925497, 28418856, 28990808 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	17936340, 30093972, 30700181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11883712, 15010475, 21152870, 23170789, 23233043, 23991105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16650817, 16925462, 19074826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	26600192		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	CTD_human_DG	17145863		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	21993564	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Diseases	Metabolic Diseases	BEFREE	29199228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28103056, 29199228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	29848111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	16476770, 25982926, 30804245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	16476770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	25982926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	24312345, 31602241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	BEFREE	24759133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	26540312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	19269113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11395381, 17476297, 17761706, 17935125, 17936340, 18757438, 18937843, 19269113, 20198321, 20740367, 23539451, 24177339, 24853422, 25295247, 26839311 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30683917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30804245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	28835277, 31751619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31668396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	24123874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	22914544, 23964081, 28101054, 28169521, 29165389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	22914544	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	16757188, 19852794, 21682866, 33763056, 38157375, 39354427	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	19264156	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	30688539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteonecrosis	Osteonecrosis	Pubtator	28628558	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28951199, 30009515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	28438620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	29291615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	17761706, 25519908, 28148395, 32365084, 33226635	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	12527925, 15138580, 16525644, 17935125, 22088471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	27248167, 28842394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	12527925, 12792776, 16525644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	17935125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	23555989, 23764046, 32537471	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	27809303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	36264979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	23555989, 36264979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	25982926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	25982926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	20530726, 26564991, 30009515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	20530726, 24042113, 26564991, 28120492, 28146220, 28951199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	24042113, 28146220, 32858090, 36246974	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	28835277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	28835277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	20131237, 28883515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	15905579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15537383, 19170048, 20623639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12534282, 17373694, 18308730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15537383, 19170048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	15102084, 29458120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	15102084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	24123874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	11704532, 11828045	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	18077203	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	20971733, 25689283, 26147947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17001320, 25773677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	24253040, 30672316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	21245013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	21245013, 30677406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	25216639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	17195212, 17328048, 20131259, 21905006, 22294633, 29875735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	17205215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	LHGDN	17727088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	24919455	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	27050058, 29415278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	30423938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	30423938	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	29875735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	17476297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	19242518, 21993564	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	15102084, 25912757, 26839311, 27615543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29224812, 31213575	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	17517084, 22941376, 28491140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	10671485, 16816379, 21488197	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	30423938		★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	30423938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	LHGDN	17205215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	28628558	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	23991105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29195005, 31341019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	31341019	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner syndrome	Pubtator	35821070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	19184329, 27096966, 30217509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33369107	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	15113859	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	31885781	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

F2RL1 (F2R like trypsin receptor 1)