Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	55770
Gene name	Exocyst complex component 2
Gene symbol	EXOC2
Synonyms (NCBI Gene)	NEDFACHSEC5SEC5L1Sec5p
Chromosome	6
Chromosome location	6p25.3
Summary	The protein encoded by this gene is a component of the exocyst complex, a multi-protein complex essential for the polarized targeting of exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component

399 Show/Hide all (399)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020620	hsa-miR-155-5p	Proteomics	18668040
MIRT023654	hsa-miR-1-3p	Proteomics	18668040
MIRT049928	hsa-miR-30a-5p	CLASH	23622248
MIRT047777	hsa-miR-30d-5p	CLASH	23622248
MIRT039714	hsa-miR-615-3p	CLASH	23622248
MIRT707677	hsa-miR-1252-3p	HITS-CLIP	21572407
MIRT707676	hsa-miR-105-5p	HITS-CLIP	21572407
MIRT707675	hsa-miR-7853-5p	HITS-CLIP	21572407
MIRT707674	hsa-miR-1250-3p	HITS-CLIP	21572407
MIRT707673	hsa-miR-153-5p	HITS-CLIP	21572407
MIRT707672	hsa-miR-203a-3p	HITS-CLIP	21572407
MIRT707671	hsa-miR-380-5p	HITS-CLIP	21572407
MIRT707670	hsa-miR-563	HITS-CLIP	21572407
MIRT707669	hsa-miR-3671	HITS-CLIP	21572407
MIRT707668	hsa-miR-607	HITS-CLIP	21572407
MIRT707667	hsa-miR-659-3p	HITS-CLIP	21572407
MIRT450607	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT450606	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT450605	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT450604	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT450603	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT450602	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT450601	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT450600	hsa-miR-548as-3p	PAR-CLIP	22100165
MIRT450599	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT450598	hsa-miR-570-3p	PAR-CLIP	22100165
MIRT707677	hsa-miR-1252-3p	HITS-CLIP	21572407
MIRT707676	hsa-miR-105-5p	HITS-CLIP	21572407
MIRT707675	hsa-miR-7853-5p	HITS-CLIP	21572407
MIRT707674	hsa-miR-1250-3p	HITS-CLIP	21572407
MIRT707673	hsa-miR-153-5p	HITS-CLIP	21572407
MIRT707672	hsa-miR-203a-3p	HITS-CLIP	21572407
MIRT707671	hsa-miR-380-5p	HITS-CLIP	21572407
MIRT707670	hsa-miR-563	HITS-CLIP	21572407
MIRT707669	hsa-miR-3671	HITS-CLIP	21572407
MIRT707668	hsa-miR-607	HITS-CLIP	21572407
MIRT707667	hsa-miR-659-3p	HITS-CLIP	21572407
MIRT450607	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT450606	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT450605	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT450604	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT450603	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT450602	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT450601	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT450600	hsa-miR-548as-3p	PAR-CLIP	22100165
MIRT450599	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT450598	hsa-miR-570-3p	PAR-CLIP	22100165
MIRT972538	hsa-miR-103a	CLIP-seq
MIRT972539	hsa-miR-105	CLIP-seq
MIRT972540	hsa-miR-107	CLIP-seq
MIRT972541	hsa-miR-1283	CLIP-seq
MIRT972542	hsa-miR-1285	CLIP-seq
MIRT972543	hsa-miR-1343	CLIP-seq
MIRT972544	hsa-miR-15a	CLIP-seq
MIRT972545	hsa-miR-15b	CLIP-seq
MIRT972546	hsa-miR-16	CLIP-seq
MIRT972547	hsa-miR-195	CLIP-seq
MIRT972548	hsa-miR-203	CLIP-seq
MIRT972549	hsa-miR-2277-3p	CLIP-seq
MIRT972550	hsa-miR-3125	CLIP-seq
MIRT972551	hsa-miR-3187-5p	CLIP-seq
MIRT972552	hsa-miR-325	CLIP-seq
MIRT972553	hsa-miR-3916	CLIP-seq
MIRT972554	hsa-miR-3945	CLIP-seq
MIRT972555	hsa-miR-424	CLIP-seq
MIRT972556	hsa-miR-4253	CLIP-seq
MIRT972557	hsa-miR-4257	CLIP-seq
MIRT972558	hsa-miR-4267	CLIP-seq
MIRT972559	hsa-miR-4310	CLIP-seq
MIRT972560	hsa-miR-4311	CLIP-seq
MIRT972561	hsa-miR-4470	CLIP-seq
MIRT972562	hsa-miR-4504	CLIP-seq
MIRT972563	hsa-miR-4729	CLIP-seq
MIRT972564	hsa-miR-4732-3p	CLIP-seq
MIRT972565	hsa-miR-4753-5p	CLIP-seq
MIRT972566	hsa-miR-497	CLIP-seq
MIRT972567	hsa-miR-520d-5p	CLIP-seq
MIRT972568	hsa-miR-524-5p	CLIP-seq
MIRT972569	hsa-miR-542-3p	CLIP-seq
MIRT972570	hsa-miR-570	CLIP-seq
MIRT972571	hsa-miR-612	CLIP-seq
MIRT972572	hsa-miR-628-3p	CLIP-seq
MIRT972573	hsa-miR-659	CLIP-seq
MIRT972574	hsa-miR-892a	CLIP-seq
MIRT972538	hsa-miR-103a	CLIP-seq
MIRT972539	hsa-miR-105	CLIP-seq
MIRT972540	hsa-miR-107	CLIP-seq
MIRT1988105	hsa-miR-1257	CLIP-seq
MIRT972542	hsa-miR-1285	CLIP-seq
MIRT972543	hsa-miR-1343	CLIP-seq
MIRT1988106	hsa-miR-1539	CLIP-seq
MIRT972544	hsa-miR-15a	CLIP-seq
MIRT972545	hsa-miR-15b	CLIP-seq
MIRT972546	hsa-miR-16	CLIP-seq
MIRT972547	hsa-miR-195	CLIP-seq
MIRT972548	hsa-miR-203	CLIP-seq
MIRT1988107	hsa-miR-205	CLIP-seq
MIRT1988108	hsa-miR-214	CLIP-seq
MIRT1988109	hsa-miR-22	CLIP-seq
MIRT972549	hsa-miR-2277-3p	CLIP-seq
MIRT1988110	hsa-miR-299-3p	CLIP-seq
MIRT1988111	hsa-miR-3151	CLIP-seq
MIRT972551	hsa-miR-3187-5p	CLIP-seq
MIRT1988112	hsa-miR-3619-5p	CLIP-seq
MIRT1988113	hsa-miR-3653	CLIP-seq
MIRT1988114	hsa-miR-3677-3p	CLIP-seq
MIRT1988115	hsa-miR-3942-3p	CLIP-seq
MIRT972554	hsa-miR-3945	CLIP-seq
MIRT972555	hsa-miR-424	CLIP-seq
MIRT972556	hsa-miR-4253	CLIP-seq
MIRT1988116	hsa-miR-4291	CLIP-seq
MIRT1988117	hsa-miR-4300	CLIP-seq
MIRT972559	hsa-miR-4310	CLIP-seq
MIRT1988118	hsa-miR-4440	CLIP-seq
MIRT1988119	hsa-miR-4447	CLIP-seq
MIRT972561	hsa-miR-4470	CLIP-seq
MIRT1988120	hsa-miR-4472	CLIP-seq
MIRT972562	hsa-miR-4504	CLIP-seq
MIRT1988121	hsa-miR-451b	CLIP-seq
MIRT1988122	hsa-miR-4763-5p	CLIP-seq
MIRT1988123	hsa-miR-4793-5p	CLIP-seq
MIRT1988124	hsa-miR-486-3p	CLIP-seq
MIRT1988125	hsa-miR-491-5p	CLIP-seq
MIRT972566	hsa-miR-497	CLIP-seq
MIRT1988126	hsa-miR-519a	CLIP-seq
MIRT1988127	hsa-miR-519b-3p	CLIP-seq
MIRT1988128	hsa-miR-519c-3p	CLIP-seq
MIRT972569	hsa-miR-542-3p	CLIP-seq
MIRT1988129	hsa-miR-558	CLIP-seq
MIRT972571	hsa-miR-612	CLIP-seq
MIRT972573	hsa-miR-659	CLIP-seq
MIRT1988130	hsa-miR-761	CLIP-seq
MIRT1988131	hsa-miR-920	CLIP-seq
MIRT1988132	hsa-miR-922	CLIP-seq
MIRT972538	hsa-miR-103a	CLIP-seq
MIRT972539	hsa-miR-105	CLIP-seq
MIRT972540	hsa-miR-107	CLIP-seq
MIRT2222582	hsa-miR-1184	CLIP-seq
MIRT2222583	hsa-miR-1197	CLIP-seq
MIRT972542	hsa-miR-1285	CLIP-seq
MIRT972543	hsa-miR-1343	CLIP-seq
MIRT2222584	hsa-miR-142-3p	CLIP-seq
MIRT2222585	hsa-miR-145	CLIP-seq
MIRT1988106	hsa-miR-1539	CLIP-seq
MIRT972544	hsa-miR-15a	CLIP-seq
MIRT972545	hsa-miR-15b	CLIP-seq
MIRT972546	hsa-miR-16	CLIP-seq
MIRT2222586	hsa-miR-181a	CLIP-seq
MIRT2222587	hsa-miR-181b	CLIP-seq
MIRT2222588	hsa-miR-181c	CLIP-seq
MIRT2222589	hsa-miR-181d	CLIP-seq
MIRT972547	hsa-miR-195	CLIP-seq
MIRT972548	hsa-miR-203	CLIP-seq
MIRT1988107	hsa-miR-205	CLIP-seq
MIRT1988108	hsa-miR-214	CLIP-seq
MIRT1988109	hsa-miR-22	CLIP-seq
MIRT972549	hsa-miR-2277-3p	CLIP-seq
MIRT1988110	hsa-miR-299-3p	CLIP-seq
MIRT2222590	hsa-miR-3074-5p	CLIP-seq
MIRT2222591	hsa-miR-3117-3p	CLIP-seq
MIRT2222592	hsa-miR-3145-3p	CLIP-seq
MIRT2222593	hsa-miR-3180-5p	CLIP-seq
MIRT972551	hsa-miR-3187-5p	CLIP-seq
MIRT972552	hsa-miR-325	CLIP-seq
MIRT2222594	hsa-miR-3618	CLIP-seq
MIRT1988112	hsa-miR-3619-5p	CLIP-seq
MIRT1988113	hsa-miR-3653	CLIP-seq
MIRT1988114	hsa-miR-3677-3p	CLIP-seq
MIRT2222595	hsa-miR-3688-5p	CLIP-seq
MIRT2222596	hsa-miR-3690	CLIP-seq
MIRT2222597	hsa-miR-376c	CLIP-seq
MIRT2222598	hsa-miR-378	CLIP-seq
MIRT2222599	hsa-miR-378b	CLIP-seq
MIRT2222600	hsa-miR-378c	CLIP-seq
MIRT2222601	hsa-miR-378d	CLIP-seq
MIRT2222602	hsa-miR-378e	CLIP-seq
MIRT2222603	hsa-miR-378f	CLIP-seq
MIRT2222604	hsa-miR-378h	CLIP-seq
MIRT2222605	hsa-miR-378i	CLIP-seq
MIRT972554	hsa-miR-3945	CLIP-seq
MIRT2222606	hsa-miR-422a	CLIP-seq
MIRT972555	hsa-miR-424	CLIP-seq
MIRT2222607	hsa-miR-4251	CLIP-seq
MIRT972556	hsa-miR-4253	CLIP-seq
MIRT2222608	hsa-miR-4254	CLIP-seq
MIRT2222609	hsa-miR-4262	CLIP-seq
MIRT972558	hsa-miR-4267	CLIP-seq
MIRT1988116	hsa-miR-4291	CLIP-seq
MIRT1988117	hsa-miR-4300	CLIP-seq
MIRT972559	hsa-miR-4310	CLIP-seq
MIRT2222610	hsa-miR-4317	CLIP-seq
MIRT1988118	hsa-miR-4440	CLIP-seq
MIRT972561	hsa-miR-4470	CLIP-seq
MIRT2222611	hsa-miR-4491	CLIP-seq
MIRT2222612	hsa-miR-4519	CLIP-seq
MIRT1988121	hsa-miR-451b	CLIP-seq
MIRT2222613	hsa-miR-4645-3p	CLIP-seq
MIRT2222614	hsa-miR-4657	CLIP-seq
MIRT2222615	hsa-miR-4676-5p	CLIP-seq
MIRT2222616	hsa-miR-4704-3p	CLIP-seq
MIRT2222617	hsa-miR-4719	CLIP-seq
MIRT2222618	hsa-miR-4762-5p	CLIP-seq
MIRT1988122	hsa-miR-4763-5p	CLIP-seq
MIRT2222619	hsa-miR-4786-3p	CLIP-seq
MIRT972566	hsa-miR-497	CLIP-seq
MIRT2222620	hsa-miR-517b	CLIP-seq
MIRT2222621	hsa-miR-539	CLIP-seq
MIRT1988129	hsa-miR-558	CLIP-seq
MIRT2222622	hsa-miR-575	CLIP-seq
MIRT2222623	hsa-miR-582-5p	CLIP-seq
MIRT972571	hsa-miR-612	CLIP-seq
MIRT972572	hsa-miR-628-3p	CLIP-seq
MIRT2222624	hsa-miR-651	CLIP-seq
MIRT972573	hsa-miR-659	CLIP-seq
MIRT1988130	hsa-miR-761	CLIP-seq
MIRT2222625	hsa-miR-887	CLIP-seq
MIRT1988131	hsa-miR-920	CLIP-seq
MIRT1988132	hsa-miR-922	CLIP-seq
MIRT2222626	hsa-miR-934	CLIP-seq
MIRT1988107	hsa-miR-205	CLIP-seq
MIRT1988108	hsa-miR-214	CLIP-seq
MIRT1988112	hsa-miR-3619-5p	CLIP-seq
MIRT1988113	hsa-miR-3653	CLIP-seq
MIRT1988116	hsa-miR-4291	CLIP-seq
MIRT1988121	hsa-miR-451b	CLIP-seq
MIRT1988130	hsa-miR-761	CLIP-seq
MIRT1988132	hsa-miR-922	CLIP-seq
MIRT2526194	hsa-miR-1207-5p	CLIP-seq
MIRT2526195	hsa-miR-1252	CLIP-seq
MIRT2526196	hsa-miR-1254	CLIP-seq
MIRT1988105	hsa-miR-1257	CLIP-seq
MIRT972541	hsa-miR-1283	CLIP-seq
MIRT2526197	hsa-miR-129-3p	CLIP-seq
MIRT2526198	hsa-miR-139-5p	CLIP-seq
MIRT2222584	hsa-miR-142-3p	CLIP-seq
MIRT2222585	hsa-miR-145	CLIP-seq
MIRT2526199	hsa-miR-1468	CLIP-seq
MIRT2526200	hsa-miR-146b-3p	CLIP-seq
MIRT2526201	hsa-miR-1825	CLIP-seq
MIRT2526202	hsa-miR-199a-5p	CLIP-seq
MIRT2526203	hsa-miR-199b-5p	CLIP-seq
MIRT2526204	hsa-miR-2054	CLIP-seq
MIRT1988108	hsa-miR-214	CLIP-seq
MIRT1988110	hsa-miR-299-3p	CLIP-seq
MIRT2526205	hsa-miR-3116	CLIP-seq
MIRT2526206	hsa-miR-3123	CLIP-seq
MIRT2526207	hsa-miR-3140-5p	CLIP-seq
MIRT2526208	hsa-miR-3143	CLIP-seq
MIRT2526209	hsa-miR-3144-5p	CLIP-seq
MIRT1988111	hsa-miR-3151	CLIP-seq
MIRT2526210	hsa-miR-3176	CLIP-seq
MIRT2526211	hsa-miR-3183	CLIP-seq
MIRT2526212	hsa-miR-3186-3p	CLIP-seq
MIRT2222594	hsa-miR-3618	CLIP-seq
MIRT2526213	hsa-miR-3619-3p	CLIP-seq
MIRT1988112	hsa-miR-3619-5p	CLIP-seq
MIRT2526214	hsa-miR-3622a-3p	CLIP-seq
MIRT2526215	hsa-miR-3622b-3p	CLIP-seq
MIRT2526216	hsa-miR-3647-3p	CLIP-seq
MIRT2526217	hsa-miR-3661	CLIP-seq
MIRT2526218	hsa-miR-3663-5p	CLIP-seq
MIRT2222596	hsa-miR-3690	CLIP-seq
MIRT2526219	hsa-miR-370	CLIP-seq
MIRT2526220	hsa-miR-3921	CLIP-seq
MIRT2526221	hsa-miR-3922-3p	CLIP-seq
MIRT2526222	hsa-miR-3924	CLIP-seq
MIRT1988115	hsa-miR-3942-3p	CLIP-seq
MIRT2222607	hsa-miR-4251	CLIP-seq
MIRT2526223	hsa-miR-4270	CLIP-seq
MIRT2526224	hsa-miR-4278	CLIP-seq
MIRT2526225	hsa-miR-4282	CLIP-seq
MIRT1988116	hsa-miR-4291	CLIP-seq
MIRT2526226	hsa-miR-4299	CLIP-seq
MIRT972560	hsa-miR-4311	CLIP-seq
MIRT2222610	hsa-miR-4317	CLIP-seq
MIRT2526227	hsa-miR-4329	CLIP-seq
MIRT2526228	hsa-miR-4441	CLIP-seq
MIRT1988119	hsa-miR-4447	CLIP-seq
MIRT2526229	hsa-miR-4449	CLIP-seq
MIRT1988120	hsa-miR-4472	CLIP-seq
MIRT2526230	hsa-miR-4496	CLIP-seq
MIRT2526231	hsa-miR-4517	CLIP-seq
MIRT2222612	hsa-miR-4519	CLIP-seq
MIRT2526232	hsa-miR-4522	CLIP-seq
MIRT2526233	hsa-miR-4653-5p	CLIP-seq
MIRT2526234	hsa-miR-4670-3p	CLIP-seq
MIRT2222615	hsa-miR-4676-5p	CLIP-seq
MIRT2526235	hsa-miR-4687-5p	CLIP-seq
MIRT2526236	hsa-miR-4709-5p	CLIP-seq
MIRT2526237	hsa-miR-4714-5p	CLIP-seq
MIRT2526238	hsa-miR-4715-5p	CLIP-seq
MIRT2222617	hsa-miR-4719	CLIP-seq
MIRT2526239	hsa-miR-4723-3p	CLIP-seq
MIRT2526240	hsa-miR-4725-5p	CLIP-seq
MIRT2526241	hsa-miR-4763-3p	CLIP-seq
MIRT2526242	hsa-miR-4766-5p	CLIP-seq
MIRT2526243	hsa-miR-4776-5p	CLIP-seq
MIRT2526244	hsa-miR-4783-3p	CLIP-seq
MIRT2222619	hsa-miR-4786-3p	CLIP-seq
MIRT2526245	hsa-miR-4786-5p	CLIP-seq
MIRT1988123	hsa-miR-4793-5p	CLIP-seq
MIRT2526246	hsa-miR-4803	CLIP-seq
MIRT1988124	hsa-miR-486-3p	CLIP-seq
MIRT1988125	hsa-miR-491-5p	CLIP-seq
MIRT2526247	hsa-miR-504	CLIP-seq
MIRT2526248	hsa-miR-513a-3p	CLIP-seq
MIRT2222620	hsa-miR-517b	CLIP-seq
MIRT1988126	hsa-miR-519a	CLIP-seq
MIRT1988127	hsa-miR-519b-3p	CLIP-seq
MIRT1988128	hsa-miR-519c-3p	CLIP-seq
MIRT972567	hsa-miR-520d-5p	CLIP-seq
MIRT972568	hsa-miR-524-5p	CLIP-seq
MIRT2526249	hsa-miR-548ac	CLIP-seq
MIRT2526250	hsa-miR-548c-3p	CLIP-seq
MIRT2526251	hsa-miR-548d-3p	CLIP-seq
MIRT2526252	hsa-miR-548p	CLIP-seq
MIRT2526253	hsa-miR-548z	CLIP-seq
MIRT2526254	hsa-miR-571	CLIP-seq
MIRT2222622	hsa-miR-575	CLIP-seq
MIRT2526255	hsa-miR-580	CLIP-seq
MIRT2526256	hsa-miR-601	CLIP-seq
MIRT2526257	hsa-miR-619	CLIP-seq
MIRT2526258	hsa-miR-631	CLIP-seq
MIRT2526259	hsa-miR-661	CLIP-seq
MIRT1988130	hsa-miR-761	CLIP-seq
MIRT1988132	hsa-miR-922	CLIP-seq
MIRT2526194	hsa-miR-1207-5p	CLIP-seq
MIRT2526195	hsa-miR-1252	CLIP-seq
MIRT1988105	hsa-miR-1257	CLIP-seq
MIRT2526197	hsa-miR-129-3p	CLIP-seq
MIRT2526198	hsa-miR-139-5p	CLIP-seq
MIRT2222585	hsa-miR-145	CLIP-seq
MIRT2526199	hsa-miR-1468	CLIP-seq
MIRT2526200	hsa-miR-146b-3p	CLIP-seq
MIRT2526201	hsa-miR-1825	CLIP-seq
MIRT2680383	hsa-miR-194	CLIP-seq
MIRT2526202	hsa-miR-199a-5p	CLIP-seq
MIRT2526203	hsa-miR-199b-5p	CLIP-seq
MIRT2526204	hsa-miR-2054	CLIP-seq
MIRT1988108	hsa-miR-214	CLIP-seq
MIRT1988110	hsa-miR-299-3p	CLIP-seq
MIRT2526209	hsa-miR-3144-5p	CLIP-seq
MIRT1988111	hsa-miR-3151	CLIP-seq
MIRT2526210	hsa-miR-3176	CLIP-seq
MIRT2526212	hsa-miR-3186-3p	CLIP-seq
MIRT2222594	hsa-miR-3618	CLIP-seq
MIRT2526213	hsa-miR-3619-3p	CLIP-seq
MIRT1988112	hsa-miR-3619-5p	CLIP-seq
MIRT2526214	hsa-miR-3622a-3p	CLIP-seq
MIRT2526215	hsa-miR-3622b-3p	CLIP-seq
MIRT2526217	hsa-miR-3661	CLIP-seq
MIRT2526218	hsa-miR-3663-5p	CLIP-seq
MIRT2222596	hsa-miR-3690	CLIP-seq
MIRT2526219	hsa-miR-370	CLIP-seq
MIRT2526220	hsa-miR-3921	CLIP-seq
MIRT2526221	hsa-miR-3922-3p	CLIP-seq
MIRT2526222	hsa-miR-3924	CLIP-seq
MIRT2222607	hsa-miR-4251	CLIP-seq
MIRT2680384	hsa-miR-4258	CLIP-seq
MIRT2526223	hsa-miR-4270	CLIP-seq
MIRT2526224	hsa-miR-4278	CLIP-seq
MIRT1988116	hsa-miR-4291	CLIP-seq
MIRT2526227	hsa-miR-4329	CLIP-seq
MIRT2526228	hsa-miR-4441	CLIP-seq
MIRT1988119	hsa-miR-4447	CLIP-seq
MIRT2526229	hsa-miR-4449	CLIP-seq
MIRT1988120	hsa-miR-4472	CLIP-seq
MIRT2526231	hsa-miR-4517	CLIP-seq
MIRT2222612	hsa-miR-4519	CLIP-seq
MIRT2526232	hsa-miR-4522	CLIP-seq
MIRT2526233	hsa-miR-4653-5p	CLIP-seq
MIRT2222615	hsa-miR-4676-5p	CLIP-seq
MIRT2526235	hsa-miR-4687-5p	CLIP-seq
MIRT2526237	hsa-miR-4714-5p	CLIP-seq
MIRT2526238	hsa-miR-4715-5p	CLIP-seq
MIRT2222617	hsa-miR-4719	CLIP-seq
MIRT2526240	hsa-miR-4725-5p	CLIP-seq
MIRT2526241	hsa-miR-4763-3p	CLIP-seq
MIRT2526243	hsa-miR-4776-5p	CLIP-seq
MIRT2526244	hsa-miR-4783-3p	CLIP-seq
MIRT2222619	hsa-miR-4786-3p	CLIP-seq
MIRT2526245	hsa-miR-4786-5p	CLIP-seq
MIRT1988124	hsa-miR-486-3p	CLIP-seq
MIRT1988125	hsa-miR-491-5p	CLIP-seq
MIRT2526247	hsa-miR-504	CLIP-seq
MIRT2526248	hsa-miR-513a-3p	CLIP-seq
MIRT1988126	hsa-miR-519a	CLIP-seq
MIRT1988127	hsa-miR-519b-3p	CLIP-seq
MIRT1988128	hsa-miR-519c-3p	CLIP-seq
MIRT2526250	hsa-miR-548c-3p	CLIP-seq
MIRT2526254	hsa-miR-571	CLIP-seq
MIRT2222622	hsa-miR-575	CLIP-seq
MIRT2526255	hsa-miR-580	CLIP-seq
MIRT2526256	hsa-miR-601	CLIP-seq
MIRT2526257	hsa-miR-619	CLIP-seq
MIRT2526258	hsa-miR-631	CLIP-seq
MIRT2680385	hsa-miR-759	CLIP-seq
MIRT1988130	hsa-miR-761	CLIP-seq
MIRT1988132	hsa-miR-922	CLIP-seq

24 Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000145	Component	Exocyst	IBA
GO:0000145	Component	Exocyst	IDA	24056301
GO:0000145	Component	Exocyst	IEA
GO:0000145	Component	Exocyst	NAS	22420621
GO:0000281	Process	Mitotic cytokinesis	NAS	22420621
GO:0005515	Function	Protein binding	IPI	12459492, 19166349, 19885391, 20579884, 24056301, 26582389, 27173435, 32296183, 33961781
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0006887	Process	Exocytosis	IBA
GO:0006887	Process	Exocytosis	IEA
GO:0006893	Process	Golgi to plasma membrane transport	IBA
GO:0006893	Process	Golgi to plasma membrane transport	IEA
GO:0006893	Process	Golgi to plasma membrane transport	IMP	32639540
GO:0006904	Process	Vesicle docking involved in exocytosis	IDA	12459492
GO:0006904	Process	Vesicle docking involved in exocytosis	NAS	22420621
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0019901	Function	Protein kinase binding	IPI	24056301
GO:0031267	Function	Small GTPase binding	IEA
GO:0031267	Function	Small GTPase binding	IPI	24056301
GO:0090148	Process	Membrane fission	NAS	22420621
GO:0090522	Process	Vesicle tethering involved in exocytosis	NAS	22420621
GO:0090543	Component	Flemming body	IEA
GO:2000535	Process	Regulation of entry of bacterium into host cell	IMP	20579884

MIM	HGNC	e!Ensembl
615329	24968	ENSG00000112685

Q96KP1

Protein name

Exocyst complex component 2 (Exocyst complex component Sec5)

Protein function

Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01833	TIG	8 → 92	IPT/TIG domain	Domain
PF15469	Sec5	198 → 377	Exocyst complex component Sec5	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with highest levels in brain and placenta. {ECO:0000269|PubMed:12459492}.

Sequence

MSRSRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKI
VCRVGQAKNDKGDIIVTTKSGGRGTSTVSFKLLKPEKIGILDQSAVWVDEMNYYDMRTDR
NKGIPPLSLRPANPLGIEIEKSKFSQKDLEMLFHGMSADFTSENFSAAWYLIENHSNTSF
EQLKMAVTNLKRQANKKSEGSLAYVKGGLSTFFEAQDALSAIHQKLEADGTEKVEGSMTQ
KLENVLNRASNTADTLFQEVLGRKDKADSTRNALNVLQRFKFLFNLPLNIERNIQKGDYD
VVINDYEKAKSLFGKTEVQVFKKYYAEVETRIEALRELLLDKLLETPSTLHDQKRYIRYL
SDLHASGDPAWQCIGAQHKWILQLMHSCKEGYVKDLKGNPGLHSPMLDLDNDTRPSVLGH
LSQTASLKRGSSFQSGRDDTWRYKTPHRVAFVEKLTKLVLSQLPNFWKLWISYVNGSLFS
ETAEKSGQIERSKNVRQRQNDFKKMIQEVMHSLVKLTRGALLPLSIRDGEAKQYGGWEVK
CELSGQWLAHAIQTVRLTHESLTALEIPNDLLQTIQDLILDLRVRCVMATLQHTAEEIKR
LAEKEDWIVDNEGLTSLPCQFEQCIVCSLQSLKGVLECKPGEASVFQQPKTQEEVCQLSI
NIMQVFIYCLEQLSTKPDADIDTTHLSVDVSSPDLFGSIHEDFSLTSEQRLLIVLSNCCY
LERHTFLNIAEHFEKHNFQGIEKITQVSMASLKELDQRLFENYIELKADPIVGSLEPGIY
AGYFDWKDCLPPTGVRNYLKEALVNIIAVHAEVFTISKELVPRVLSKVIEAVSEELSRLM
QCVSSFSKNGALQARLEICALRDTVAVYLTPESKSSFKQALEALPQLSSGADKKLLEELL
NKFKSSMHLQLTCFQAASSTMMKT

Sequence length

924

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Ras signaling pathway	Insulin processing
Salmonella infection	VxPx cargo-targeting to cilium

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Neurodevelopmental disorder with dysmorphic facies and cerebellar hypoplasia	Pathogenic	rs2127584790	RCV001387537	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (38)
ANDROGENETIC ALOPECIA	—	GWAS catalog	28196072, 30573740	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	25574825, 40164604	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	30595370	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	21700618, 27539887, 33549134, 36496446, 38182794	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM NON-HODGKIN LYMPHOMA	—	GWAS catalog	31102405	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	21131588, 28112199, 28165464, 39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
complex neurodevelopmental disorder	—	ClinGen	12575951, 26582389, 30510181, 32639540, ClinGen report	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	23064961	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFUSE LARGE B-CELL LYMPHOMA	—	GWAS catalog	25261932	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUPUYTREN CONTRACTURE	—	GWAS catalog	38172110	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	32121467	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EXOC2-related disorder	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC ULCER	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	GWAS catalog	30054594, 31959993, 35841873, 39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHOID	—	GWAS catalog	33888516	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKINS LYMPHOMA	—	GWAS catalog	28112199, 36273105	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY SKIN DISEASE	—	GWAS catalog	25574825	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIMITED SCLERODERMA	—	GWAS catalog	29293537	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	28604730	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHATIC SYSTEM CANCER	—	GWAS catalog	40465716	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOID LEUKEMIA	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA	—	GWAS catalog	34594039	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	GWAS catalog	28212542	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	32121467	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	GWAS catalog	28112199, 36273105, 40883272	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	31604244	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	32887889, 36273105, 37340002, 40465716	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	23548203, 29739929, 34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	29891935, 33627673, 37386247, 39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	23143594, 25574825, 25903422, 39885523	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	24390342, 30423114, 36333501	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	22885689	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASE	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	34127860, 39749473	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	34127860, 39749473	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WALDENSTROM MACROGLOBULINEMIA	—	GWAS catalog	30305637	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (26)
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	27115168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	GWASCAT_DG	28196072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	26949549, 36776048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	32639540	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20145037	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	21700618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	21700618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Color Vision Defects	Color vision deficiency	Pubtator	18483556	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31502714	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	32639540	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	25611436, 27115168		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	Pubtator	32639540	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	32736695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	GWASCAT_DG	30054594		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma, Open-Angle	Glaucoma	GWASCAT_DG	29891935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	30305637	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	20619549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17018283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor Skills Disorders	Motor skills disorder	Pubtator	32639540	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	20619549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	GWASDB_DG	23143594		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASCAT_DG	23143594, 25574825		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Neoplasms	Skin neoplasm	Pubtator	23548203	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
SPONDYLOCARPOTARSAL SYNOSTOSIS SYNDROME	Spondylocarpotarsal Synostosis Syndrome	BEFREE	29293537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	30305637	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	30305637		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
EXOC7	1	["complex neurodevelopmental disorder"]	3	["Salmonella infection","Insulin processing","VxPx cargo-targeting to cilium"]	5	["ClinGen (Neurodevelopmental disorder)","GWAS catalog (Neurodevelopmental disorder)","ClinVar (Neurodevelopmental disorder)","HPO (Neurodevelopmental disorder)","ClinGen (complex neurodevelopmental disorder)"]
IRF4	14	["Autoimmune disease","Central nervous system non-hodgkin lymphoma","Lymphocytic leukemia","Hodgkin lymphoma","Crest syndrome","Diffuse large b-cell lymphoma","Gastric ulcer","Lymphoma","Lymphoid leukemia","Multiple myeloma","Non-hodgkins lymphoma","Non-melanoma skin carcinoma"]	0	[]	16	["GWAS catalog (Autoimmune disease)","GWAS catalog (Basal cell carcinoma)","GWAS catalog (Central nervous system non-hodgkin lymphoma)","GWAS catalog (Lymphocytic leukemia)","GWAS catalog (Hodgkin lymphoma)","GWAS catalog (Melanoma)","GWAS catalog (Diffuse large b-cell lymphoma)","GWAS catalog (Gastric ulcer)","GWAS catalog (Crest syndrome)","GWAS catalog (Lymphoma)","GWAS catalog (Lymphoid leukemia)","GWAS catalog (Multiple myeloma)"]
EXOC5	0	[]	3	["Salmonella infection","Insulin processing","VxPx cargo-targeting to cilium"]	0	[]
EXOC4	0	[]	3	["Salmonella infection","Insulin processing","VxPx cargo-targeting to cilium"]	0	[]
EXOC6	2	["Lymphocytic leukemia","Diffuse large b-cell lymphoma"]	2	["Insulin processing","VxPx cargo-targeting to cilium"]	2	["GWAS catalog (Lymphocytic leukemia)","GWAS catalog (Diffuse large b-cell lymphoma)"]

EXOC2 (exocyst complex component 2)

Bookmark This Gene