Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	51614
Gene name	ERGIC and golgi 3
Gene symbol	ERGIC3
Synonyms (NCBI Gene)	C20orf47C2orf47CGI-54Erv46NY-BR-84PRO0989SDBCAG84dJ477O4.2
Chromosome	20
Chromosome location	20q11.22

62 Show/Hide all (62)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007115	hsa-miR-490-3p	GFP reporter assay	23212913
MIRT007115	hsa-miR-490-3p	GFP reporter assay	23212913
MIRT032333	hsa-let-7b-5p	Proteomics	18668040
MIRT968941	hsa-miR-1275	CLIP-seq
MIRT968942	hsa-miR-140-3p	CLIP-seq
MIRT968943	hsa-miR-151-5p	CLIP-seq
MIRT968944	hsa-miR-151b	CLIP-seq
MIRT968945	hsa-miR-1972	CLIP-seq
MIRT968946	hsa-miR-2467-3p	CLIP-seq
MIRT968947	hsa-miR-3689d	CLIP-seq
MIRT968948	hsa-miR-4270	CLIP-seq
MIRT968949	hsa-miR-4441	CLIP-seq
MIRT968950	hsa-miR-4505	CLIP-seq
MIRT968951	hsa-miR-4525	CLIP-seq
MIRT968952	hsa-miR-4656	CLIP-seq
MIRT968953	hsa-miR-4665-5p	CLIP-seq
MIRT968954	hsa-miR-4723-5p	CLIP-seq
MIRT968955	hsa-miR-4731-5p	CLIP-seq
MIRT968956	hsa-miR-485-5p	CLIP-seq
MIRT968957	hsa-miR-625	CLIP-seq
MIRT968958	hsa-miR-637	CLIP-seq
MIRT968941	hsa-miR-1275	CLIP-seq
MIRT968942	hsa-miR-140-3p	CLIP-seq
MIRT968943	hsa-miR-151-5p	CLIP-seq
MIRT968944	hsa-miR-151b	CLIP-seq
MIRT968945	hsa-miR-1972	CLIP-seq
MIRT968946	hsa-miR-2467-3p	CLIP-seq
MIRT968959	hsa-miR-3125	CLIP-seq
MIRT968960	hsa-miR-3150b-3p	CLIP-seq
MIRT968947	hsa-miR-3689d	CLIP-seq
MIRT968961	hsa-miR-3916	CLIP-seq
MIRT968948	hsa-miR-4270	CLIP-seq
MIRT968962	hsa-miR-4283	CLIP-seq
MIRT968949	hsa-miR-4441	CLIP-seq
MIRT968963	hsa-miR-4489	CLIP-seq
MIRT968964	hsa-miR-4492	CLIP-seq
MIRT968965	hsa-miR-4498	CLIP-seq
MIRT968950	hsa-miR-4505	CLIP-seq
MIRT968951	hsa-miR-4525	CLIP-seq
MIRT968952	hsa-miR-4656	CLIP-seq
MIRT968953	hsa-miR-4665-5p	CLIP-seq
MIRT968966	hsa-miR-4705	CLIP-seq
MIRT968967	hsa-miR-4714-3p	CLIP-seq
MIRT968954	hsa-miR-4723-5p	CLIP-seq
MIRT968955	hsa-miR-4731-5p	CLIP-seq
MIRT968968	hsa-miR-4784	CLIP-seq
MIRT968956	hsa-miR-485-5p	CLIP-seq
MIRT968969	hsa-miR-583	CLIP-seq
MIRT968957	hsa-miR-625	CLIP-seq
MIRT968958	hsa-miR-637	CLIP-seq
MIRT968970	hsa-miR-762	CLIP-seq
MIRT968948	hsa-miR-4270	CLIP-seq
MIRT968949	hsa-miR-4441	CLIP-seq
MIRT968969	hsa-miR-583	CLIP-seq
MIRT968962	hsa-miR-4283	CLIP-seq
MIRT968963	hsa-miR-4489	CLIP-seq
MIRT968964	hsa-miR-4492	CLIP-seq
MIRT968965	hsa-miR-4498	CLIP-seq
MIRT968950	hsa-miR-4505	CLIP-seq
MIRT968967	hsa-miR-4714-3p	CLIP-seq
MIRT968955	hsa-miR-4731-5p	CLIP-seq
MIRT968970	hsa-miR-762	CLIP-seq

19 Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IBA
GO:0005515	Function	Protein binding	IPI	15308636, 31142615, 32296183, 33961781
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	IBA
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	IDA	31142615
GO:0006890	Process	Retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IBA
GO:0006890	Process	Retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	NAS	31142615
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0030134	Component	COPII-coated ER to Golgi transport vesicle	IBA
GO:0033116	Component	Endoplasmic reticulum-Golgi intermediate compartment membrane	IEA
GO:0061852	Component	Retrograde transporter complex, Golgi to ER	IPI	31142615
GO:0090316	Process	Positive regulation of intracellular protein transport	IMP	31142615
GO:1990351	Component	Transporter complex	IPI	31142615

MIM	HGNC	e!Ensembl
616971	15927	ENSG00000125991

Q9Y282

Protein name

Endoplasmic reticulum-Golgi intermediate compartment protein 3 (Serologically defined breast cancer antigen NY-BR-84)

Protein function

Possible role in transport between endoplasmic reticulum and Golgi. Positively regulates trafficking of the secretory proteins SERPINA1/alpha1-antitrypsin and HP/haptoglobin (PubMed:31142615).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07970	COPIIcoated_ERV	145 → 363	Endoplasmic reticulum vesicle transporter	Family
PF13850	ERGIC_N	7 → 97	Endoplasmic Reticulum-Golgi Intermediate Compartment (ERGIC)	Domain

Sequence

MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYV
DKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAE
RHELGKVEVTVFDPDSLDPDRCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIE
QCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNI
NMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQF
SVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAG
LIDSLIYHSARAIQKKIDLGKTT

Sequence length

383

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Developmental disorder	Likely pathogenic	rs2515204602	RCV003441161	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	27588471	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL DISABILITIES	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	27588471	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (11)
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23374247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23212913, 35602902	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23374247, 26177443, 27588471, 31530266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23374247, 26177443	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	27588471		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of lung	Lung Cancer	BEFREE	23374247, 26177443, 27588471, 31530266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	27588471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26177443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26177443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	27588471		★★★★★ ★☆☆☆☆ Found in Text Mining only

ERGIC3 (ERGIC and golgi 3)

Save This Analysis