CHD4 (chromodomain helicase DNA binding protein 4)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 1108
• Gene name: Chromodomain helicase DNA binding protein 4
• Gene symbol: CHD4
• Synonyms (NCBI Gene): CHD-4, Mi-2b, Mi2-BETA, SIHIWES
• Chromosome: 12
• Chromosome location: 12p13.31
• Summary: The product of this gene belongs to the SNF2/RAD54 helicase family. It represents the main component of the nucleosome remodeling and deacetylase complex and plays an important role in epigenetic transcriptional repression. Patients with dermatomyositis d

SNPs Show/Hide all (14)

SNP ID	Visualize variation	Clinical significance	Consequence
rs886039915	C>T	Pathogenic	Coding sequence variant, missense variant
rs886039916	G>T	Pathogenic	Coding sequence variant, missense variant
rs886039917	C>T	Pathogenic	Coding sequence variant, missense variant
rs886039918	C>A	Pathogenic	Coding sequence variant, missense variant
rs886039919	C>A	Pathogenic	Coding sequence variant, missense variant
rs1057520911	A>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1060499583	A>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1064795757	C>G	Likely-pathogenic	Missense variant, coding sequence variant
rs1064795878	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs1377989582	T>A,G	Likely-pathogenic	Missense variant, coding sequence variant
rs1555170507	C>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1555171293	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1592270989	G>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1592273799	T>C	Likely-pathogenic	Missense variant, coding sequence variant

miRNA Show/Hide all (664)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004656	hsa-miR-491-5p	Luciferase reporter assay	20065103
MIRT016455	hsa-miR-193b-3p	Proteomics	21512034
MIRT027771	hsa-miR-98-5p	Microarray	19088304
MIRT032436	hsa-let-7b-5p	Proteomics	18668040
MIRT032436	hsa-let-7b-5p	CLASH	23622248
MIRT051330	hsa-miR-15a-5p	CLASH	23622248
MIRT050859	hsa-miR-17-5p	CLASH	23622248
MIRT048143	hsa-miR-197-3p	CLASH	23622248
MIRT041696	hsa-miR-484	CLASH	23622248
MIRT016455	hsa-miR-193b-3p	CLASH	23622248
MIRT039684	hsa-miR-615-3p	CLASH	23622248
MIRT039684	hsa-miR-615-3p	CLASH	23622248
MIRT039684	hsa-miR-615-3p	CLASH	23622248
MIRT036982	hsa-miR-877-3p	CLASH	23622248
MIRT036982	hsa-miR-877-3p	CLASH	23622248
MIRT036982	hsa-miR-877-3p	CLASH	23622248
MIRT715937	hsa-miR-483-3p	HITS-CLIP	19536157
MIRT715936	hsa-miR-6890-3p	HITS-CLIP	19536157
MIRT715935	hsa-miR-361-3p	HITS-CLIP	19536157
MIRT715934	hsa-miR-6887-3p	HITS-CLIP	19536157
MIRT715933	hsa-miR-6795-3p	HITS-CLIP	19536157
MIRT715932	hsa-miR-1470	HITS-CLIP	19536157
MIRT715931	hsa-miR-4667-3p	HITS-CLIP	19536157
MIRT715930	hsa-miR-4469	HITS-CLIP	19536157
MIRT715929	hsa-miR-1913	HITS-CLIP	19536157
MIRT715928	hsa-miR-324-3p	HITS-CLIP	19536157
MIRT715927	hsa-miR-4749-3p	HITS-CLIP	19536157
MIRT715926	hsa-miR-210-5p	HITS-CLIP	19536157
MIRT715925	hsa-miR-6826-3p	HITS-CLIP	19536157
MIRT715924	hsa-miR-1229-3p	HITS-CLIP	19536157
MIRT661397	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT609307	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT609306	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT636837	hsa-miR-29b-2-5p	HITS-CLIP	23824327
MIRT661396	hsa-miR-491-3p	HITS-CLIP	23824327
MIRT609305	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT636835	hsa-miR-659-3p	HITS-CLIP	23824327
MIRT609307	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT609306	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT636837	hsa-miR-29b-2-5p	HITS-CLIP	23824327
MIRT609305	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT636835	hsa-miR-659-3p	HITS-CLIP	23824327
MIRT609307	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT609306	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT609305	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT609307	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT609306	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT609305	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT609307	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT609306	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT636837	hsa-miR-29b-2-5p	HITS-CLIP	23824327
MIRT609305	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT636835	hsa-miR-659-3p	HITS-CLIP	23824327
MIRT634870	hsa-miR-6746-3p	HITS-CLIP	23824327
MIRT609308	hsa-miR-205-3p	HITS-CLIP	23824327
MIRT634869	hsa-miR-4729	HITS-CLIP	23824327
MIRT634868	hsa-miR-5696	HITS-CLIP	23824327
MIRT634867	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT634866	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT609307	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT609306	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT609305	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT609307	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT609306	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT609305	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT609307	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT609306	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT609305	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT609307	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT609306	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT609305	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT609307	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT609306	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT609305	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT609307	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT609306	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT609305	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT609308	hsa-miR-205-3p	HITS-CLIP	23824327
MIRT609307	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT609306	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT609305	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT498640	hsa-miR-548aa	PAR-CLIP	20371350
MIRT498639	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT498638	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT498637	hsa-miR-548as-3p	PAR-CLIP	20371350
MIRT498636	hsa-miR-548at-3p	PAR-CLIP	20371350
MIRT498635	hsa-miR-548ay-3p	PAR-CLIP	20371350
MIRT498634	hsa-miR-497-3p	PAR-CLIP	20371350
MIRT498633	hsa-miR-3173-3p	PAR-CLIP	20371350
MIRT498631	hsa-miR-6891-5p	PAR-CLIP	20371350
MIRT498632	hsa-miR-3065-5p	PAR-CLIP	20371350
MIRT525589	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT479281	hsa-miR-4774-5p	PAR-CLIP	20371350
MIRT479280	hsa-miR-5189-3p	PAR-CLIP	20371350
MIRT479279	hsa-miR-5589-5p	PAR-CLIP	20371350
MIRT562800	hsa-miR-6069	PAR-CLIP	20371350
MIRT479278	hsa-miR-23a-5p	PAR-CLIP	20371350
MIRT479277	hsa-miR-23b-5p	PAR-CLIP	20371350
MIRT479276	hsa-miR-5681b	PAR-CLIP	20371350
MIRT479275	hsa-miR-1343-3p	PAR-CLIP	20371350
MIRT479274	hsa-miR-6783-3p	PAR-CLIP	20371350
MIRT498640	hsa-miR-548aa	PAR-CLIP	20371350
MIRT498639	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT498638	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT498637	hsa-miR-548as-3p	PAR-CLIP	20371350
MIRT498636	hsa-miR-548at-3p	PAR-CLIP	20371350
MIRT498635	hsa-miR-548ay-3p	PAR-CLIP	20371350
MIRT498634	hsa-miR-497-3p	PAR-CLIP	20371350
MIRT498632	hsa-miR-3065-5p	PAR-CLIP	20371350
MIRT498640	hsa-miR-548aa	PAR-CLIP	20371350
MIRT498639	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT498638	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT498637	hsa-miR-548as-3p	PAR-CLIP	20371350
MIRT498636	hsa-miR-548at-3p	PAR-CLIP	20371350
MIRT498635	hsa-miR-548ay-3p	PAR-CLIP	20371350
MIRT498634	hsa-miR-497-3p	PAR-CLIP	20371350
MIRT498633	hsa-miR-3173-3p	PAR-CLIP	20371350
MIRT498631	hsa-miR-6891-5p	PAR-CLIP	20371350
MIRT498632	hsa-miR-3065-5p	PAR-CLIP	20371350
MIRT525589	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT479281	hsa-miR-4774-5p	PAR-CLIP	20371350
MIRT479280	hsa-miR-5189-3p	PAR-CLIP	20371350
MIRT479279	hsa-miR-5589-5p	PAR-CLIP	20371350
MIRT479278	hsa-miR-23a-5p	PAR-CLIP	20371350
MIRT479277	hsa-miR-23b-5p	PAR-CLIP	20371350
MIRT479276	hsa-miR-5681b	PAR-CLIP	20371350
MIRT479275	hsa-miR-1343-3p	PAR-CLIP	20371350
MIRT479274	hsa-miR-6783-3p	PAR-CLIP	20371350
MIRT498640	hsa-miR-548aa	PAR-CLIP	20371350
MIRT498639	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT498638	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT498637	hsa-miR-548as-3p	PAR-CLIP	20371350
MIRT498636	hsa-miR-548at-3p	PAR-CLIP	20371350
MIRT498635	hsa-miR-548ay-3p	PAR-CLIP	20371350
MIRT498634	hsa-miR-497-3p	PAR-CLIP	20371350
MIRT498633	hsa-miR-3173-3p	PAR-CLIP	20371350
MIRT498631	hsa-miR-6891-5p	PAR-CLIP	20371350
MIRT498632	hsa-miR-3065-5p	PAR-CLIP	20371350
MIRT525589	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT479281	hsa-miR-4774-5p	PAR-CLIP	20371350
MIRT479280	hsa-miR-5189-3p	PAR-CLIP	20371350
MIRT479279	hsa-miR-5589-5p	PAR-CLIP	20371350
MIRT562800	hsa-miR-6069	PAR-CLIP	20371350
MIRT479278	hsa-miR-23a-5p	PAR-CLIP	20371350
MIRT479277	hsa-miR-23b-5p	PAR-CLIP	20371350
MIRT479276	hsa-miR-5681b	PAR-CLIP	20371350
MIRT479275	hsa-miR-1343-3p	PAR-CLIP	20371350
MIRT479274	hsa-miR-6783-3p	PAR-CLIP	20371350
MIRT479281	hsa-miR-4774-5p	PAR-CLIP	20371350
MIRT479280	hsa-miR-5189-3p	PAR-CLIP	20371350
MIRT479279	hsa-miR-5589-5p	PAR-CLIP	20371350
MIRT479278	hsa-miR-23a-5p	PAR-CLIP	20371350
MIRT479277	hsa-miR-23b-5p	PAR-CLIP	20371350
MIRT479276	hsa-miR-5681b	PAR-CLIP	20371350
MIRT479275	hsa-miR-1343-3p	PAR-CLIP	20371350
MIRT479274	hsa-miR-6783-3p	PAR-CLIP	20371350
MIRT498640	hsa-miR-548aa	PAR-CLIP	21572407
MIRT498639	hsa-miR-548ap-3p	PAR-CLIP	21572407
MIRT498638	hsa-miR-548t-3p	PAR-CLIP	21572407
MIRT498637	hsa-miR-548as-3p	PAR-CLIP	21572407
MIRT498636	hsa-miR-548at-3p	PAR-CLIP	21572407
MIRT498635	hsa-miR-548ay-3p	PAR-CLIP	21572407
MIRT498634	hsa-miR-497-3p	PAR-CLIP	21572407
MIRT498633	hsa-miR-3173-3p	PAR-CLIP	21572407
MIRT498631	hsa-miR-6891-5p	PAR-CLIP	21572407
MIRT498632	hsa-miR-3065-5p	PAR-CLIP	21572407
MIRT525589	hsa-miR-766-5p	PAR-CLIP	21572407
MIRT498640	hsa-miR-548aa	PAR-CLIP	22012620
MIRT498639	hsa-miR-548ap-3p	PAR-CLIP	22012620
MIRT498638	hsa-miR-548t-3p	PAR-CLIP	22012620
MIRT498637	hsa-miR-548as-3p	PAR-CLIP	22012620
MIRT498636	hsa-miR-548at-3p	PAR-CLIP	22012620
MIRT498635	hsa-miR-548ay-3p	PAR-CLIP	22012620
MIRT498634	hsa-miR-497-3p	PAR-CLIP	22012620
MIRT498633	hsa-miR-3173-3p	PAR-CLIP	22012620
MIRT498631	hsa-miR-6891-5p	PAR-CLIP	22012620
MIRT498632	hsa-miR-3065-5p	PAR-CLIP	22012620
MIRT525589	hsa-miR-766-5p	PAR-CLIP	22012620
MIRT498640	hsa-miR-548aa	PAR-CLIP	23446348
MIRT498639	hsa-miR-548ap-3p	PAR-CLIP	23446348
MIRT498638	hsa-miR-548t-3p	PAR-CLIP	23446348
MIRT498637	hsa-miR-548as-3p	PAR-CLIP	23446348
MIRT498636	hsa-miR-548at-3p	PAR-CLIP	23446348
MIRT498635	hsa-miR-548ay-3p	PAR-CLIP	23446348
MIRT498634	hsa-miR-497-3p	PAR-CLIP	23446348
MIRT498632	hsa-miR-3065-5p	PAR-CLIP	23446348
MIRT479281	hsa-miR-4774-5p	PAR-CLIP	23446348
MIRT479280	hsa-miR-5189-3p	PAR-CLIP	23446348
MIRT479279	hsa-miR-5589-5p	PAR-CLIP	23446348
MIRT479278	hsa-miR-23a-5p	PAR-CLIP	23446348
MIRT479277	hsa-miR-23b-5p	PAR-CLIP	23446348
MIRT479276	hsa-miR-5681b	PAR-CLIP	23446348
MIRT479275	hsa-miR-1343-3p	PAR-CLIP	23446348
MIRT479274	hsa-miR-6783-3p	PAR-CLIP	23446348
MIRT498640	hsa-miR-548aa	PAR-CLIP	24398324
MIRT498639	hsa-miR-548ap-3p	PAR-CLIP	24398324
MIRT498638	hsa-miR-548t-3p	PAR-CLIP	24398324
MIRT498637	hsa-miR-548as-3p	PAR-CLIP	24398324
MIRT498636	hsa-miR-548at-3p	PAR-CLIP	24398324
MIRT498635	hsa-miR-548ay-3p	PAR-CLIP	24398324
MIRT498634	hsa-miR-497-3p	PAR-CLIP	24398324
MIRT498633	hsa-miR-3173-3p	PAR-CLIP	24398324
MIRT498631	hsa-miR-6891-5p	PAR-CLIP	24398324
MIRT498632	hsa-miR-3065-5p	PAR-CLIP	24398324
MIRT479281	hsa-miR-4774-5p	PAR-CLIP	23592263
MIRT479280	hsa-miR-5189-3p	PAR-CLIP	23592263
MIRT479279	hsa-miR-5589-5p	PAR-CLIP	23592263
MIRT479278	hsa-miR-23a-5p	PAR-CLIP	23592263
MIRT479277	hsa-miR-23b-5p	PAR-CLIP	23592263
MIRT479276	hsa-miR-5681b	PAR-CLIP	23592263
MIRT479275	hsa-miR-1343-3p	PAR-CLIP	23592263
MIRT479274	hsa-miR-6783-3p	PAR-CLIP	23592263
MIRT715936	hsa-miR-6890-3p	PAR-CLIP	26701625
MIRT498632	hsa-miR-3065-5p	PAR-CLIP	27292025
MIRT498632	hsa-miR-3065-5p	PAR-CLIP	27292025
MIRT498632	hsa-miR-3065-5p	PAR-CLIP	27292025
MIRT498632	hsa-miR-3065-5p	PAR-CLIP	27292025
MIRT498634	hsa-miR-497-3p	PAR-CLIP	27292025
MIRT498634	hsa-miR-497-3p	PAR-CLIP	27292025
MIRT498634	hsa-miR-497-3p	PAR-CLIP	27292025
MIRT498634	hsa-miR-497-3p	PAR-CLIP	27292025
MIRT498640	hsa-miR-548aa	PAR-CLIP	27292025
MIRT498640	hsa-miR-548aa	PAR-CLIP	27292025
MIRT498640	hsa-miR-548aa	PAR-CLIP	27292025
MIRT498640	hsa-miR-548aa	PAR-CLIP	27292025
MIRT498639	hsa-miR-548ap-3p	PAR-CLIP	27292025
MIRT498639	hsa-miR-548ap-3p	PAR-CLIP	27292025
MIRT498639	hsa-miR-548ap-3p	PAR-CLIP	27292025
MIRT498639	hsa-miR-548ap-3p	PAR-CLIP	27292025
MIRT498637	hsa-miR-548as-3p	PAR-CLIP	27292025
MIRT498637	hsa-miR-548as-3p	PAR-CLIP	27292025
MIRT498637	hsa-miR-548as-3p	PAR-CLIP	27292025
MIRT498637	hsa-miR-548as-3p	PAR-CLIP	27292025
MIRT498636	hsa-miR-548at-3p	PAR-CLIP	27292025
MIRT498636	hsa-miR-548at-3p	PAR-CLIP	27292025
MIRT498636	hsa-miR-548at-3p	PAR-CLIP	27292025
MIRT498636	hsa-miR-548at-3p	PAR-CLIP	27292025
MIRT498635	hsa-miR-548ay-3p	PAR-CLIP	27292025
MIRT498635	hsa-miR-548ay-3p	PAR-CLIP	27292025
MIRT498635	hsa-miR-548ay-3p	PAR-CLIP	27292025
MIRT498635	hsa-miR-548ay-3p	PAR-CLIP	27292025
MIRT498638	hsa-miR-548t-3p	PAR-CLIP	27292025
MIRT498638	hsa-miR-548t-3p	PAR-CLIP	27292025
MIRT498638	hsa-miR-548t-3p	PAR-CLIP	27292025
MIRT498638	hsa-miR-548t-3p	PAR-CLIP	27292025
MIRT609308	hsa-miR-205-3p	HITS-CLIP	27418678
MIRT636837	hsa-miR-29b-2-5p	HITS-CLIP	27418678
MIRT661397	hsa-miR-3140-3p	HITS-CLIP	27418678
MIRT609305	hsa-miR-3692-3p	HITS-CLIP	27418678
MIRT609306	hsa-miR-4436b-5p	HITS-CLIP	27418678
MIRT609307	hsa-miR-6509-3p	HITS-CLIP	27418678
MIRT636835	hsa-miR-659-3p	HITS-CLIP	27418678
MIRT715937	hsa-miR-483-3p	HITS-CLIP	19536157
MIRT715936	hsa-miR-6890-3p	HITS-CLIP	19536157
MIRT715935	hsa-miR-361-3p	HITS-CLIP	19536157
MIRT715934	hsa-miR-6887-3p	HITS-CLIP	19536157
MIRT715933	hsa-miR-6795-3p	HITS-CLIP	19536157
MIRT715932	hsa-miR-1470	HITS-CLIP	19536157
MIRT715931	hsa-miR-4667-3p	HITS-CLIP	19536157
MIRT715930	hsa-miR-4469	HITS-CLIP	19536157
MIRT715929	hsa-miR-1913	HITS-CLIP	19536157
MIRT715928	hsa-miR-324-3p	HITS-CLIP	19536157
MIRT715927	hsa-miR-4749-3p	HITS-CLIP	19536157
MIRT715926	hsa-miR-210-5p	HITS-CLIP	19536157
MIRT715925	hsa-miR-6826-3p	HITS-CLIP	19536157
MIRT715924	hsa-miR-1229-3p	HITS-CLIP	19536157
MIRT661397	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT609307	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT609306	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT636837	hsa-miR-29b-2-5p	HITS-CLIP	23824327
MIRT661396	hsa-miR-491-3p	HITS-CLIP	23824327
MIRT609305	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT636835	hsa-miR-659-3p	HITS-CLIP	23824327
MIRT609307	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT609306	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT636837	hsa-miR-29b-2-5p	HITS-CLIP	23824327
MIRT609305	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT636835	hsa-miR-659-3p	HITS-CLIP	23824327
MIRT609307	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT609306	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT609305	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT609307	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT609306	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT609305	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT609307	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT609306	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT636837	hsa-miR-29b-2-5p	HITS-CLIP	23824327
MIRT609305	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT636835	hsa-miR-659-3p	HITS-CLIP	23824327
MIRT634870	hsa-miR-6746-3p	HITS-CLIP	23824327
MIRT609308	hsa-miR-205-3p	HITS-CLIP	23824327
MIRT634869	hsa-miR-4729	HITS-CLIP	23824327
MIRT634868	hsa-miR-5696	HITS-CLIP	23824327
MIRT634867	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT634866	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT609307	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT609306	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT609305	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT609307	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT609306	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT609305	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT609307	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT609306	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT609305	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT609307	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT609306	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT609305	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT609307	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT609306	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT609305	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT609307	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT609306	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT609305	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT609308	hsa-miR-205-3p	HITS-CLIP	23824327
MIRT609307	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT609306	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT609305	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT498640	hsa-miR-548aa	PAR-CLIP	20371350
MIRT498639	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT498638	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT498637	hsa-miR-548as-3p	PAR-CLIP	20371350
MIRT498636	hsa-miR-548at-3p	PAR-CLIP	20371350
MIRT498635	hsa-miR-548ay-3p	PAR-CLIP	20371350
MIRT498634	hsa-miR-497-3p	PAR-CLIP	20371350
MIRT498633	hsa-miR-3173-3p	PAR-CLIP	20371350
MIRT498631	hsa-miR-6891-5p	PAR-CLIP	20371350
MIRT498632	hsa-miR-3065-5p	PAR-CLIP	20371350
MIRT525589	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT479281	hsa-miR-4774-5p	PAR-CLIP	20371350
MIRT479280	hsa-miR-5189-3p	PAR-CLIP	20371350
MIRT479279	hsa-miR-5589-5p	PAR-CLIP	20371350
MIRT562800	hsa-miR-6069	PAR-CLIP	20371350
MIRT479278	hsa-miR-23a-5p	PAR-CLIP	20371350
MIRT479277	hsa-miR-23b-5p	PAR-CLIP	20371350
MIRT479276	hsa-miR-5681b	PAR-CLIP	20371350
MIRT479275	hsa-miR-1343-3p	PAR-CLIP	20371350
MIRT479274	hsa-miR-6783-3p	PAR-CLIP	20371350
MIRT498640	hsa-miR-548aa	PAR-CLIP	20371350
MIRT498639	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT498638	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT498637	hsa-miR-548as-3p	PAR-CLIP	20371350
MIRT498636	hsa-miR-548at-3p	PAR-CLIP	20371350
MIRT498635	hsa-miR-548ay-3p	PAR-CLIP	20371350
MIRT498634	hsa-miR-497-3p	PAR-CLIP	20371350
MIRT498632	hsa-miR-3065-5p	PAR-CLIP	20371350
MIRT498640	hsa-miR-548aa	PAR-CLIP	20371350
MIRT498639	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT498638	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT498637	hsa-miR-548as-3p	PAR-CLIP	20371350
MIRT498636	hsa-miR-548at-3p	PAR-CLIP	20371350
MIRT498635	hsa-miR-548ay-3p	PAR-CLIP	20371350
MIRT498634	hsa-miR-497-3p	PAR-CLIP	20371350
MIRT498633	hsa-miR-3173-3p	PAR-CLIP	20371350
MIRT498631	hsa-miR-6891-5p	PAR-CLIP	20371350
MIRT498632	hsa-miR-3065-5p	PAR-CLIP	20371350
MIRT525589	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT479281	hsa-miR-4774-5p	PAR-CLIP	20371350
MIRT479280	hsa-miR-5189-3p	PAR-CLIP	20371350
MIRT479279	hsa-miR-5589-5p	PAR-CLIP	20371350
MIRT479278	hsa-miR-23a-5p	PAR-CLIP	20371350
MIRT479277	hsa-miR-23b-5p	PAR-CLIP	20371350
MIRT479276	hsa-miR-5681b	PAR-CLIP	20371350
MIRT479275	hsa-miR-1343-3p	PAR-CLIP	20371350
MIRT479274	hsa-miR-6783-3p	PAR-CLIP	20371350
MIRT498640	hsa-miR-548aa	PAR-CLIP	20371350
MIRT498639	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT498638	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT498637	hsa-miR-548as-3p	PAR-CLIP	20371350
MIRT498636	hsa-miR-548at-3p	PAR-CLIP	20371350
MIRT498635	hsa-miR-548ay-3p	PAR-CLIP	20371350
MIRT498634	hsa-miR-497-3p	PAR-CLIP	20371350
MIRT498633	hsa-miR-3173-3p	PAR-CLIP	20371350
MIRT498631	hsa-miR-6891-5p	PAR-CLIP	20371350
MIRT498632	hsa-miR-3065-5p	PAR-CLIP	20371350
MIRT525589	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT479281	hsa-miR-4774-5p	PAR-CLIP	20371350
MIRT479280	hsa-miR-5189-3p	PAR-CLIP	20371350
MIRT479279	hsa-miR-5589-5p	PAR-CLIP	20371350
MIRT562800	hsa-miR-6069	PAR-CLIP	20371350
MIRT479278	hsa-miR-23a-5p	PAR-CLIP	20371350
MIRT479277	hsa-miR-23b-5p	PAR-CLIP	20371350
MIRT479276	hsa-miR-5681b	PAR-CLIP	20371350
MIRT479275	hsa-miR-1343-3p	PAR-CLIP	20371350
MIRT479274	hsa-miR-6783-3p	PAR-CLIP	20371350
MIRT479281	hsa-miR-4774-5p	PAR-CLIP	20371350
MIRT479280	hsa-miR-5189-3p	PAR-CLIP	20371350
MIRT479279	hsa-miR-5589-5p	PAR-CLIP	20371350
MIRT479278	hsa-miR-23a-5p	PAR-CLIP	20371350
MIRT479277	hsa-miR-23b-5p	PAR-CLIP	20371350
MIRT479276	hsa-miR-5681b	PAR-CLIP	20371350
MIRT479275	hsa-miR-1343-3p	PAR-CLIP	20371350
MIRT479274	hsa-miR-6783-3p	PAR-CLIP	20371350
MIRT498640	hsa-miR-548aa	PAR-CLIP	21572407
MIRT498639	hsa-miR-548ap-3p	PAR-CLIP	21572407
MIRT498638	hsa-miR-548t-3p	PAR-CLIP	21572407
MIRT498637	hsa-miR-548as-3p	PAR-CLIP	21572407
MIRT498636	hsa-miR-548at-3p	PAR-CLIP	21572407
MIRT498635	hsa-miR-548ay-3p	PAR-CLIP	21572407
MIRT498634	hsa-miR-497-3p	PAR-CLIP	21572407
MIRT498633	hsa-miR-3173-3p	PAR-CLIP	21572407
MIRT498631	hsa-miR-6891-5p	PAR-CLIP	21572407
MIRT498632	hsa-miR-3065-5p	PAR-CLIP	21572407
MIRT525589	hsa-miR-766-5p	PAR-CLIP	21572407
MIRT498640	hsa-miR-548aa	PAR-CLIP	22012620
MIRT498639	hsa-miR-548ap-3p	PAR-CLIP	22012620
MIRT498638	hsa-miR-548t-3p	PAR-CLIP	22012620
MIRT498637	hsa-miR-548as-3p	PAR-CLIP	22012620
MIRT498636	hsa-miR-548at-3p	PAR-CLIP	22012620
MIRT498635	hsa-miR-548ay-3p	PAR-CLIP	22012620
MIRT498634	hsa-miR-497-3p	PAR-CLIP	22012620
MIRT498633	hsa-miR-3173-3p	PAR-CLIP	22012620
MIRT498631	hsa-miR-6891-5p	PAR-CLIP	22012620
MIRT498632	hsa-miR-3065-5p	PAR-CLIP	22012620
MIRT525589	hsa-miR-766-5p	PAR-CLIP	22012620
MIRT498640	hsa-miR-548aa	PAR-CLIP	23446348
MIRT498639	hsa-miR-548ap-3p	PAR-CLIP	23446348
MIRT498638	hsa-miR-548t-3p	PAR-CLIP	23446348
MIRT498637	hsa-miR-548as-3p	PAR-CLIP	23446348
MIRT498636	hsa-miR-548at-3p	PAR-CLIP	23446348
MIRT498635	hsa-miR-548ay-3p	PAR-CLIP	23446348
MIRT498634	hsa-miR-497-3p	PAR-CLIP	23446348
MIRT498632	hsa-miR-3065-5p	PAR-CLIP	23446348
MIRT479281	hsa-miR-4774-5p	PAR-CLIP	23446348
MIRT479280	hsa-miR-5189-3p	PAR-CLIP	23446348
MIRT479279	hsa-miR-5589-5p	PAR-CLIP	23446348
MIRT479278	hsa-miR-23a-5p	PAR-CLIP	23446348
MIRT479277	hsa-miR-23b-5p	PAR-CLIP	23446348
MIRT479276	hsa-miR-5681b	PAR-CLIP	23446348
MIRT479275	hsa-miR-1343-3p	PAR-CLIP	23446348
MIRT479274	hsa-miR-6783-3p	PAR-CLIP	23446348
MIRT498640	hsa-miR-548aa	PAR-CLIP	24398324
MIRT498639	hsa-miR-548ap-3p	PAR-CLIP	24398324
MIRT498638	hsa-miR-548t-3p	PAR-CLIP	24398324
MIRT498637	hsa-miR-548as-3p	PAR-CLIP	24398324
MIRT498636	hsa-miR-548at-3p	PAR-CLIP	24398324
MIRT498635	hsa-miR-548ay-3p	PAR-CLIP	24398324
MIRT498634	hsa-miR-497-3p	PAR-CLIP	24398324
MIRT498633	hsa-miR-3173-3p	PAR-CLIP	24398324
MIRT498631	hsa-miR-6891-5p	PAR-CLIP	24398324
MIRT498632	hsa-miR-3065-5p	PAR-CLIP	24398324
MIRT479281	hsa-miR-4774-5p	PAR-CLIP	23592263
MIRT479280	hsa-miR-5189-3p	PAR-CLIP	23592263
MIRT479279	hsa-miR-5589-5p	PAR-CLIP	23592263
MIRT479278	hsa-miR-23a-5p	PAR-CLIP	23592263
MIRT479277	hsa-miR-23b-5p	PAR-CLIP	23592263
MIRT479276	hsa-miR-5681b	PAR-CLIP	23592263
MIRT479275	hsa-miR-1343-3p	PAR-CLIP	23592263
MIRT479274	hsa-miR-6783-3p	PAR-CLIP	23592263
MIRT889145	hsa-miR-1207-5p	CLIP-seq
MIRT889146	hsa-miR-147	CLIP-seq
MIRT889147	hsa-miR-1976	CLIP-seq
MIRT889148	hsa-miR-198	CLIP-seq
MIRT889149	hsa-miR-3150a-3p	CLIP-seq
MIRT889150	hsa-miR-3158-5p	CLIP-seq
MIRT889151	hsa-miR-3175	CLIP-seq
MIRT889152	hsa-miR-3194-5p	CLIP-seq
MIRT889153	hsa-miR-3692	CLIP-seq
MIRT889154	hsa-miR-3914	CLIP-seq
MIRT889155	hsa-miR-3942-3p	CLIP-seq
MIRT889156	hsa-miR-4258	CLIP-seq
MIRT889157	hsa-miR-4267	CLIP-seq
MIRT889158	hsa-miR-4434	CLIP-seq
MIRT889159	hsa-miR-4493	CLIP-seq
MIRT889160	hsa-miR-4516	CLIP-seq
MIRT889161	hsa-miR-4659a-3p	CLIP-seq
MIRT889162	hsa-miR-4659b-3p	CLIP-seq
MIRT889163	hsa-miR-4707-3p	CLIP-seq
MIRT889164	hsa-miR-4709-5p	CLIP-seq
MIRT889165	hsa-miR-4736	CLIP-seq
MIRT889166	hsa-miR-4738-5p	CLIP-seq
MIRT889167	hsa-miR-4753-5p	CLIP-seq
MIRT889168	hsa-miR-4763-3p	CLIP-seq
MIRT889169	hsa-miR-4786-3p	CLIP-seq
MIRT889170	hsa-miR-498	CLIP-seq
MIRT889171	hsa-miR-566	CLIP-seq
MIRT889172	hsa-miR-579	CLIP-seq
MIRT889173	hsa-miR-599	CLIP-seq
MIRT889174	hsa-miR-652	CLIP-seq
MIRT889175	hsa-miR-873	CLIP-seq
MIRT889176	hsa-miR-939	CLIP-seq
MIRT1546426	hsa-miR-1184	CLIP-seq
MIRT1546427	hsa-miR-1205	CLIP-seq
MIRT1546428	hsa-miR-1286	CLIP-seq
MIRT889150	hsa-miR-3158-5p	CLIP-seq
MIRT1546429	hsa-miR-3202	CLIP-seq
MIRT1546430	hsa-miR-4476	CLIP-seq
MIRT1546431	hsa-miR-4722-5p	CLIP-seq
MIRT1546432	hsa-miR-544	CLIP-seq
MIRT1963488	hsa-let-7a	CLIP-seq
MIRT1963489	hsa-let-7b	CLIP-seq
MIRT1963490	hsa-let-7c	CLIP-seq
MIRT1963491	hsa-let-7d	CLIP-seq
MIRT1963492	hsa-let-7e	CLIP-seq
MIRT1963493	hsa-let-7f	CLIP-seq
MIRT1963494	hsa-let-7g	CLIP-seq
MIRT1963495	hsa-let-7i	CLIP-seq
MIRT1546426	hsa-miR-1184	CLIP-seq
MIRT1546427	hsa-miR-1205	CLIP-seq
MIRT1963496	hsa-miR-1236	CLIP-seq
MIRT1546428	hsa-miR-1286	CLIP-seq
MIRT1963497	hsa-miR-1302	CLIP-seq
MIRT1963498	hsa-miR-148a	CLIP-seq
MIRT1963499	hsa-miR-148b	CLIP-seq
MIRT1963500	hsa-miR-152	CLIP-seq
MIRT1963501	hsa-miR-1825	CLIP-seq
MIRT1963502	hsa-miR-1915	CLIP-seq
MIRT889150	hsa-miR-3158-5p	CLIP-seq
MIRT889151	hsa-miR-3175	CLIP-seq
MIRT1963503	hsa-miR-3182	CLIP-seq
MIRT1546429	hsa-miR-3202	CLIP-seq
MIRT1963504	hsa-miR-320e	CLIP-seq
MIRT1963505	hsa-miR-3609	CLIP-seq
MIRT1963506	hsa-miR-3915	CLIP-seq
MIRT1963507	hsa-miR-3928	CLIP-seq
MIRT1963508	hsa-miR-3974	CLIP-seq
MIRT1963509	hsa-miR-4257	CLIP-seq
MIRT1963510	hsa-miR-4283	CLIP-seq
MIRT1963511	hsa-miR-4298	CLIP-seq
MIRT1963512	hsa-miR-4326	CLIP-seq
MIRT889158	hsa-miR-4434	CLIP-seq
MIRT1963513	hsa-miR-4458	CLIP-seq
MIRT1546430	hsa-miR-4476	CLIP-seq
MIRT1963514	hsa-miR-4489	CLIP-seq
MIRT1963515	hsa-miR-4500	CLIP-seq
MIRT889160	hsa-miR-4516	CLIP-seq
MIRT1963516	hsa-miR-4675	CLIP-seq
MIRT1963517	hsa-miR-4687-3p	CLIP-seq
MIRT1963518	hsa-miR-4711-3p	CLIP-seq
MIRT1546431	hsa-miR-4722-5p	CLIP-seq
MIRT1963519	hsa-miR-4741	CLIP-seq
MIRT1963520	hsa-miR-4802-3p	CLIP-seq
MIRT1963521	hsa-miR-493	CLIP-seq
MIRT1546432	hsa-miR-544	CLIP-seq
MIRT1963522	hsa-miR-548ah	CLIP-seq
MIRT1963523	hsa-miR-593	CLIP-seq
MIRT1963524	hsa-miR-98	CLIP-seq
MIRT1963488	hsa-let-7a	CLIP-seq
MIRT1963489	hsa-let-7b	CLIP-seq
MIRT1963490	hsa-let-7c	CLIP-seq
MIRT1963491	hsa-let-7d	CLIP-seq
MIRT1963492	hsa-let-7e	CLIP-seq
MIRT1963493	hsa-let-7f	CLIP-seq
MIRT1963494	hsa-let-7g	CLIP-seq
MIRT1963495	hsa-let-7i	CLIP-seq
MIRT889145	hsa-miR-1207-5p	CLIP-seq
MIRT2199930	hsa-miR-1266	CLIP-seq
MIRT1963498	hsa-miR-148a	CLIP-seq
MIRT1963499	hsa-miR-148b	CLIP-seq
MIRT1963500	hsa-miR-152	CLIP-seq
MIRT1963501	hsa-miR-1825	CLIP-seq
MIRT1963502	hsa-miR-1915	CLIP-seq
MIRT2199931	hsa-miR-1972	CLIP-seq
MIRT889147	hsa-miR-1976	CLIP-seq
MIRT889150	hsa-miR-3158-5p	CLIP-seq
MIRT889151	hsa-miR-3175	CLIP-seq
MIRT889152	hsa-miR-3194-5p	CLIP-seq
MIRT1963505	hsa-miR-3609	CLIP-seq
MIRT2199932	hsa-miR-3664-3p	CLIP-seq
MIRT889154	hsa-miR-3914	CLIP-seq
MIRT1963506	hsa-miR-3915	CLIP-seq
MIRT1963507	hsa-miR-3928	CLIP-seq
MIRT889155	hsa-miR-3942-3p	CLIP-seq
MIRT1963508	hsa-miR-3974	CLIP-seq
MIRT1963509	hsa-miR-4257	CLIP-seq
MIRT889156	hsa-miR-4258	CLIP-seq
MIRT889157	hsa-miR-4267	CLIP-seq
MIRT2199933	hsa-miR-4427	CLIP-seq
MIRT889158	hsa-miR-4434	CLIP-seq
MIRT1963513	hsa-miR-4458	CLIP-seq
MIRT1546430	hsa-miR-4476	CLIP-seq
MIRT1963515	hsa-miR-4500	CLIP-seq
MIRT889160	hsa-miR-4516	CLIP-seq
MIRT2199934	hsa-miR-4518	CLIP-seq
MIRT2199935	hsa-miR-4650-5p	CLIP-seq
MIRT889161	hsa-miR-4659a-3p	CLIP-seq
MIRT889162	hsa-miR-4659b-3p	CLIP-seq
MIRT2199936	hsa-miR-4680-3p	CLIP-seq
MIRT2199937	hsa-miR-4690-3p	CLIP-seq
MIRT889163	hsa-miR-4707-3p	CLIP-seq
MIRT889164	hsa-miR-4709-5p	CLIP-seq
MIRT1963518	hsa-miR-4711-3p	CLIP-seq
MIRT2199938	hsa-miR-4714-5p	CLIP-seq
MIRT889165	hsa-miR-4736	CLIP-seq
MIRT889166	hsa-miR-4738-5p	CLIP-seq
MIRT889168	hsa-miR-4763-3p	CLIP-seq
MIRT1963521	hsa-miR-493	CLIP-seq
MIRT889170	hsa-miR-498	CLIP-seq
MIRT1963522	hsa-miR-548ah	CLIP-seq
MIRT889171	hsa-miR-566	CLIP-seq
MIRT889174	hsa-miR-652	CLIP-seq
MIRT889175	hsa-miR-873	CLIP-seq
MIRT1963524	hsa-miR-98	CLIP-seq
MIRT1963498	hsa-miR-148a	CLIP-seq
MIRT1963499	hsa-miR-148b	CLIP-seq
MIRT1963500	hsa-miR-152	CLIP-seq
MIRT1963501	hsa-miR-1825	CLIP-seq
MIRT1963498	hsa-miR-148a	CLIP-seq
MIRT1963499	hsa-miR-148b	CLIP-seq
MIRT1963500	hsa-miR-152	CLIP-seq
MIRT1963501	hsa-miR-1825	CLIP-seq
MIRT1963505	hsa-miR-3609	CLIP-seq
MIRT1963506	hsa-miR-3915	CLIP-seq
MIRT1963507	hsa-miR-3928	CLIP-seq
MIRT1963508	hsa-miR-3974	CLIP-seq
MIRT1546430	hsa-miR-4476	CLIP-seq
MIRT1963521	hsa-miR-493	CLIP-seq
MIRT1963522	hsa-miR-548ah	CLIP-seq
MIRT2502661	hsa-miR-1182	CLIP-seq
MIRT2502662	hsa-miR-1252	CLIP-seq
MIRT2199930	hsa-miR-1266	CLIP-seq
MIRT1963497	hsa-miR-1302	CLIP-seq
MIRT1963498	hsa-miR-148a	CLIP-seq
MIRT1963499	hsa-miR-148b	CLIP-seq
MIRT1963500	hsa-miR-152	CLIP-seq
MIRT1963501	hsa-miR-1825	CLIP-seq
MIRT1963502	hsa-miR-1915	CLIP-seq
MIRT2199931	hsa-miR-1972	CLIP-seq
MIRT2502663	hsa-miR-298	CLIP-seq
MIRT889151	hsa-miR-3175	CLIP-seq
MIRT1963504	hsa-miR-320e	CLIP-seq
MIRT2199932	hsa-miR-3664-3p	CLIP-seq
MIRT1963510	hsa-miR-4283	CLIP-seq
MIRT1963511	hsa-miR-4298	CLIP-seq
MIRT1963512	hsa-miR-4326	CLIP-seq
MIRT2502664	hsa-miR-4426	CLIP-seq
MIRT889158	hsa-miR-4434	CLIP-seq
MIRT1546430	hsa-miR-4476	CLIP-seq
MIRT1963514	hsa-miR-4489	CLIP-seq
MIRT889160	hsa-miR-4516	CLIP-seq
MIRT2199934	hsa-miR-4518	CLIP-seq
MIRT2502665	hsa-miR-4647	CLIP-seq
MIRT2199935	hsa-miR-4650-5p	CLIP-seq
MIRT2502666	hsa-miR-4662b	CLIP-seq
MIRT1963516	hsa-miR-4675	CLIP-seq
MIRT1963517	hsa-miR-4687-3p	CLIP-seq
MIRT2502667	hsa-miR-4710	CLIP-seq
MIRT1963519	hsa-miR-4741	CLIP-seq
MIRT1963520	hsa-miR-4802-3p	CLIP-seq
MIRT2502668	hsa-miR-7	CLIP-seq
MIRT2502661	hsa-miR-1182	CLIP-seq
MIRT2502662	hsa-miR-1252	CLIP-seq
MIRT2199930	hsa-miR-1266	CLIP-seq
MIRT1963498	hsa-miR-148a	CLIP-seq
MIRT1963499	hsa-miR-148b	CLIP-seq
MIRT1963500	hsa-miR-152	CLIP-seq
MIRT1963501	hsa-miR-1825	CLIP-seq
MIRT2199931	hsa-miR-1972	CLIP-seq
MIRT2502663	hsa-miR-298	CLIP-seq
MIRT2199932	hsa-miR-3664-3p	CLIP-seq
MIRT1963510	hsa-miR-4283	CLIP-seq
MIRT1963512	hsa-miR-4326	CLIP-seq
MIRT2502664	hsa-miR-4426	CLIP-seq
MIRT1546430	hsa-miR-4476	CLIP-seq
MIRT1963514	hsa-miR-4489	CLIP-seq
MIRT2199934	hsa-miR-4518	CLIP-seq
MIRT2502665	hsa-miR-4647	CLIP-seq
MIRT2199935	hsa-miR-4650-5p	CLIP-seq
MIRT2502666	hsa-miR-4662b	CLIP-seq
MIRT1963516	hsa-miR-4675	CLIP-seq
MIRT1963517	hsa-miR-4687-3p	CLIP-seq
MIRT2502667	hsa-miR-4710	CLIP-seq
MIRT1963519	hsa-miR-4741	CLIP-seq
MIRT1963520	hsa-miR-4802-3p	CLIP-seq
MIRT2502668	hsa-miR-7	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
MBD2	Unknown	23071088

Gene ontology (GO) Show/Hide all (61)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0000724	Process	Double-strand break repair via homologous recombination	IMP	25593309
GO:0000781	Component	Chromosome, telomeric region	IDA	25150861
GO:0000785	Component	Chromatin	HDA	16217013
GO:0000785	Component	Chromatin	IBA
GO:0001221	Function	Transcription coregulator binding	IPI	29795351
GO:0003677	Function	DNA binding	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	9326634
GO:0003682	Function	Chromatin binding	IBA
GO:0003714	Function	Transcription corepressor activity	IDA	33859416
GO:0005515	Function	Protein binding	IPI	9804427, 10220385, 17314511, 19644445, 20693977, 21258344, 21555454, 22720776, 23752268, 25150861, 26859351, 26949739, 28977666, 30134174, 33961781, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	28977666, 33283408
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	22720776
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	17626165
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	17626165
GO:0005813	Component	Centrosome	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	HDA	16217013
GO:0006338	Process	Chromatin remodeling	IBA
GO:0006338	Process	Chromatin remodeling	IDA	9790534
GO:0006338	Process	Chromatin remodeling	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	TAS	7560064
GO:0010629	Process	Negative regulation of gene expression	IDA	33859416
GO:0010629	Process	Negative regulation of gene expression	IGI	33301730
GO:0015671	Process	Oxygen transport	IDA	19065339, 22096240
GO:0016020	Component	Membrane	HDA	19946888
GO:0016581	Component	NuRD complex	IBA
GO:0016581	Component	NuRD complex	IDA	19644445, 33283408
GO:0016581	Component	NuRD complex	IEA
GO:0016581	Component	NuRD complex	NAS	16428440
GO:0016787	Function	Hydrolase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0016887	Function	ATP hydrolysis activity	IDA	28977666
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0031492	Function	Nucleosomal DNA binding	HDA	16217013
GO:0032991	Component	Protein-containing complex	HDA	16217013
GO:0042393	Function	Histone binding	IBA
GO:0042659	Process	Regulation of cell fate specification	NAS	22560079
GO:0042826	Function	Histone deacetylase binding	IPI	27616479
GO:0045892	Process	Negative regulation of DNA-templated transcription	NAS	22560079
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	19927129
GO:0046872	Function	Metal ion binding	IEA
GO:0051963	Process	Regulation of synapse assembly	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	22926524
GO:0072553	Process	Terminal button organization	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IDA	29795351
GO:0090734	Component	Site of DNA damage	IDA	25593309
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:0140658	Function	ATP-dependent chromatin remodeler activity	IBA
GO:0140658	Function	ATP-dependent chromatin remodeler activity	IDA	28977666
GO:0150048	Component	Cerebellar granule cell to Purkinje cell synapse	IEA
GO:2000736	Process	Regulation of stem cell differentiation	NAS	22560079

Other IDs

• MIM: 603277
• HGNC: 1919
• e!Ensembl: ENSG00000111642

Protein

• UniProt ID: Q14839
• Protein name: Chromodomain-helicase-DNA-binding protein 4 (CHD-4) (EC 3.6.4.-) (ATP-dependent helicase CHD4) (Mi-2 autoantigen 218 kDa protein) (Mi2-beta)
• Protein function: ATP-dependent chromatin-remodeling factor that binds and distorts nucleosomal DNA (PubMed:28977666, PubMed:32543371). Acts as a component of the histone deacetylase NuRD complex which participates in the remodeling of chromatin (PubMed:16428440,
• PDB: 1MM2 , 1MM3 , 2EE1 , 2L5U , 2L75 , 2N5N , 4O9I , 6BGG , 6Q3M , 6RYR , 6RYU , 8D4Y
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00176	SNF2_N	699 → 1025	SNF2 family N-terminal domain	Family
  PF00271	Helicase_C	1050 → 1164	Helicase conserved C-terminal domain	Family
  PF00385	Chromo	622 → 674	Chromo (CHRromatin Organisation MOdifier) domain	Domain
  PF00628	PHD	372 → 417	PHD-finger	Domain
  PF00628	PHD	451 → 496	PHD-finger	Domain
  PF06461	DUF1086	1380 → 1521	Domain of Unknown Function (DUF1086)	Domain
  PF06465	DUF1087	1292 → 1352	Domain of Unknown Function (DUF1087)	Domain
  PF08073	CHDNT	164 → 217	CHDNT (NUC034) domain	Domain
  PF08074	CHDCT2	1725 → 1851	CHDCT2 (NUC038) domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:28977666}.
• Sequence:

  MASGLGSPSPCSAGSEEEDMDALLNNSLPPPHPENEEDPEEDLSETETPKLKKKKKPKKP
  RDPKIPKSKRQKKERMLLCRQLGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKL
  GPKKEKKSKSKRKEEEEEEDDDDDSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKA
  FSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFKGSSGASVAAAAAAAVAVVESM
  VTATEVAPPPPPVEVPIRKAKTKEGKGPNARRKPKGSPRVPDAKKPKPKKVAPLKIKLGG
  FGSKRKRSSSEDDDLDVESDFDDASINSYSVSDGSTSRSSRSRKKLRTTKKKKKGEEEVT
  AVDGYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQ
  WEAKEDNSEGEEILEEVGGDLEEEDDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPL
  PEIPNGEWLCPRCTCPALKGKVQKILIWKWGQPPSPTPVPRPPDADPNTPSPKPLEGRPE
  RQFFVKWQGMSYWHCSWVSELQLELHCQVMFRNYQRKNDMDEPPSGDFGGDEEKSRKRKN
  KDPKFAEMEERFYRYGIKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVE
  IQDYDLFKQSYWNHRELMRGEEGRPGKKLKKVKLRKLERPPETPTVDPTVKYERQPEYLD
  ATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLV
  SAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKE
  ASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLL
  TGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKA
  DVFKNMPSKTELIVRVELSPMQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCN
  HPYLFPVAAMEAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQMTKMLD
  LLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADT
  VIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVR
  PGLGSKTGSMSKQELDDILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDDKAIERLLDR
  NQDETEDTELQGMNEYLSSFKVAQYVVREEEMGEEEEVEREIIKQEESVDPDYWEKLLRH
  HYEQQQEDLARNLGKGKRIRKQVNYNDGSQEDRDWQDDQSDNQSDYSVASEEGDEDFDER
  SEAPRRPSRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRYGMPPQDAFT
  TQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMS
  LIRKKVQEFEHVNGRWSMPELAEVEENKKMSQPGSPSPKTPTPSTPGDTQPNTPAPVPPA
  EDGIKIEENSLKEEESIEGEKEVKSTAPETAIECTQAPAPASEDEKVVVEPPEGEEKVEK
  AEVKERTEEPMETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETP
  KDLNDEKQKKNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLAG
  IINHGYARWQDIQNDPRYAILNEPFKGEMNRGNFLEIKNKFLARRFKLLEQALVIEEQLR
  RAAYLNMSEDPSHPSMALNTRFAEVECLAESHQHLSKESMAGNKPANAVLHKVLKQLEEL
  LSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLANRAPEPTPQQVAQQQ

• Sequence length: 1912

Pathways

KEGG Pathway	Reactome Pathway
ATP-dependent chromatin remodeling	HDACs deacetylate histones
Human papillomavirus infection	Regulation of TP53 Activity through Acetylation
Viral carcinogenesis	RNA Polymerase I Transcription Initiation
	Regulation of PTEN gene transcription
	NGF-stimulated transcription

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal Show/Hide Causal Diseases (6)
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
CHD4-related disorder	Likely pathogenic; Pathogenic	rs2136213384, rs2540396222, rs2540391121, rs1555170507	RCV003978459 RCV003391665 RCV003898920 RCV004545782	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Moyamoya angiopathy with developmental delay	Likely pathogenic	rs1948532502, rs1229933151, rs1435884753, rs1948698590	RCV001261729 RCV001261730 RCV001261686 RCV001261727	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neonatal encephalopathy	Likely pathogenic	rs2540401004	RCV003154302	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Ovarian serous cystadenocarcinoma	Likely pathogenic	rs2136221257	RCV005922502	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Sifrim-Hitz-Weiss syndrome	Likely pathogenic; Pathogenic	rs1948326461, rs1948326612, rs1948327010, rs2136215102, rs751534948, rs2136209186, rs2540383458, rs1948436363, rs2540383441, rs2540395856, rs2540390261, rs886039915, rs886039916, rs886039917, rs886039918, rs886039919, rs2540395930, rs2540403868, rs2540397438, rs2540411694, rs2540412378, rs2540397477, rs1060499583, rs1592270989, rs1592273799, rs2540395943, rs1948590484, rs1948453702, rs1948336129, rs2136209158	RCV001331855 RCV001331854 RCV001331853 RCV001733839 RCV001780771 RCV002071027 RCV002289029 RCV002471301 RCV002471824 RCV002470507 RCV002790046 RCV000256595 RCV000257090 RCV000257626 RCV000256716 RCV000257253 RCV005860369 RCV003325927 RCV003335934 RCV003447732 RCV003493279 RCV004546892 RCV000477959 RCV000988778 RCV001028101 RCV001252456 RCV001254126 RCV001255698 RCV001263459 RCV001264743 RCV001527387	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Uterine corpus endometrial carcinoma	Pathogenic	rs886039917	RCV005895457	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (24)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Acute myeloid leukemia	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	40645996	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	30559488	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cleft palate	Conflicting classifications of pathogenicity	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL DISABILITIES	—	CTD, Disgenet CTD, Disgenet	30559488	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASMS	—	CTD	23104009	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENETIC PREDISPOSITION TO DISEASE	—	CTD	35362730	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma susceptibility 1	Conflicting classifications of pathogenicity	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Global developmental delay	Uncertain significance	ClinVar Disgenet	—	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Intellectual disability	Uncertain significance; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	30008631	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental abnormality	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet CTD, Disgenet	21743468	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	35362730	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
syndromic intellectual disability	—	ClinGen	ClinGen report	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TETRALOGY OF FALLOT	—	CTD	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thalidomide response	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	32541925, 38374256, 39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (101)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	26265695		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29667179		★☆☆☆☆ Found in Text Mining only
Adult Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	28549031		★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	27760049		★☆☆☆☆ Found in Text Mining only
Ambiguous Genitalia	Ambiguous Genitalia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Apraxia of Phonation	Apraxia	BEFREE	31737996		★☆☆☆☆ Found in Text Mining only
Apraxias	Apraxia	Pubtator	31949314	Associate	★☆☆☆☆ Found in Text Mining only
Arnold Chiari Malformation	Arnold-Chiari malformation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Arrhythmias Cardiac	Cardiac arrhythmias	Pubtator	34109749	Associate	★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	31474762	Associate	★☆☆☆☆ Found in Text Mining only
Astigmatism	Astigmatism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	31146125		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	CTD_human_DG	30559488		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Blepharoptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	31388190	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27779108		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33741961, 38281186	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30043858, 32070428	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	38179759	Associate	★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	28940304	Associate	★☆☆☆☆ Found in Text Mining only
Child Development Deviations	Development Disorder	CTD_human_DG	30559488		★☆☆☆☆ Found in Text Mining only
Child Development Disorders, Specific	Development Disorder	CTD_human_DG	30559488		★☆☆☆☆ Found in Text Mining only
Childhood Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	28549031		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28486105		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23708667, 31438571, 33994851	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	31388190	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Epicanthus	Congenital Epicanthus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	30616054		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	29722858		★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	9790534	Associate	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	CTD_human_DG	30559488		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Developmental Disabilities	Developmental disability	Pubtator	31238879, 31388190, 31474762	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35521759	Associate	★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	CLINVAR_DG	20693977, 22302795, 24348274, 25849321, 26116663, 27418512, 27479907, 27616479, 28135719		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	CTD_human_DG	23104009		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	27997699, 29844320, 29888111		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	CTD_human_DG	23104009		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	Pubtator	34109749	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Idiopathic Generalized	Epilepsy	Pubtator	34109749	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	28130400	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24440720, 30872624		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30872624	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24440720, 30872624		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29272522		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	29272522	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	31388190	Associate	★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	31474762, 31941532, 32341405	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	31949314	Associate	★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	Pubtator	31388190	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	30938432		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	31146125, 31737996		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual Disability	Intellectual developmental disorder	Pubtator	31474762, 31949314	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual Disability	Mental retardation	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disabilities	Learning disorders	Pubtator	32341405	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	29599201, 35839448	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	29253671, 29599201	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26265695		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26095183		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	30008631	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31438571, 35821222	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	30043858	Associate	★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	BEFREE	31737996		★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27779108, 30967373		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	27997699, 29888111		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	26095183		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25407497, 28842166, 29113150, 29844320, 29888111, 29888431, 30872624		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	28549031		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	33741961	Associate	★☆☆☆☆ Found in Text Mining only
Moyamoya disease 1	Moyamoya disease	Pubtator	31474762	Associate	★☆☆☆☆ Found in Text Mining only
Multiple congenital anomalies	Multiple Congenital Anomalies	CLINVAR_DG	20693977, 22302795, 24348274, 25849321, 26116663, 27418512, 27479907, 27616479, 28135719		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26265695, 27779108, 28486105, 28842166, 31438571		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	31388190		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	36937804	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	27791010	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25737278, 27791010, 34161330	Associate	★☆☆☆☆ Found in Text Mining only
Penis agenesis	Penis Agenesis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	31085655, 31123064		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36095024	Associate	★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	36937804	Associate	★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	31438571		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett syndrome	Pubtator	37408271	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	32744500	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	CTD_human_DG	21743468		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SIFRIM-HITZ-WEISS SYNDROME	SIFRIM-HITZ-WEISS SYNDROME	UNIPROT_DG	27479907, 27616479		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
SIFRIM-HITZ-WEISS SYNDROME	SIFRIM-HITZ-WEISS SYNDROME	CLINVAR_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
SIFRIM-HITZ-WEISS SYNDROME	SIFRIM-HITZ-WEISS SYNDROME	GENOMICS_ENGLAND_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Small cell carcinoma of lung	Lung carcinoma	BEFREE	29888431		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33315534, 36362284	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30043858, 35821222	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tetralogy of Fallot	Tetralogy of Fallot	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	33419089	Associate	★☆☆☆☆ Found in Text Mining only
Trigonocephaly	Trigonocephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29305962, 31639396		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37970920	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	31949314	Associate	★☆☆☆☆ Found in Text Mining only
Vesico-Ureteral Reflux	Vesicoureteral Reflux	HPO_DG			★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

NAA15 3 shared diseasesDevelopmental disability, Tetralogy of fallot, syndromic intellectual disability 3 shared evidence sourcesDisgenet (Developmental disability), CTD (Tetralogy of fallot), ClinGen (syndromic intellectual disability) Related via 3 shared diseases including Developmental disability, Tetralogy of fallot — evidence mostly Disgenet. ARHGEF5 2 shared diseasesGenetic predisposition to disease, Lung neoplasms 2 shared evidence sourcesCTD (Genetic predisposition to disease), CTD (Lung neoplasms) Related via 2 shared diseases including Genetic predisposition to disease, Lung neoplasms — evidence mostly CTD. ZNF595 2 shared diseasesGenetic predisposition to disease, Lung neoplasms 2 shared evidence sourcesCTD (Genetic predisposition to disease), CTD (Lung neoplasms) Related via 2 shared diseases including Genetic predisposition to disease, Lung neoplasms — evidence mostly CTD. AS3MT 2 shared diseasesDevelopmental disability, Lung neoplasms 4 shared evidence sourcesDisgenet (Developmental disability), CTD (Developmental disability), CTD (Lung neoplasms), CTD (Schizophrenia) Related via 2 shared diseases including Developmental disability, Lung neoplasms — evidence mostly CTD. ERGIC3 2 shared diseasesDevelopmental disability, Lung neoplasms 2 shared evidence sourcesDisgenet (Developmental disability), CTD (Lung neoplasms) Related via 2 shared diseases including Developmental disability, Lung neoplasms — evidence mostly Disgenet.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
NAA15	3	["Developmental disability","Tetralogy of fallot","syndromic intellectual disability"]	0	[]	3	["Disgenet (Developmental disability)","CTD (Tetralogy of fallot)","ClinGen (syndromic intellectual disability)"]
ARHGEF5	2	["Genetic predisposition to disease","Lung neoplasms"]	0	[]	2	["CTD (Genetic predisposition to disease)","CTD (Lung neoplasms)"]
ZNF595	2	["Genetic predisposition to disease","Lung neoplasms"]	0	[]	2	["CTD (Genetic predisposition to disease)","CTD (Lung neoplasms)"]
AS3MT	2	["Developmental disability","Lung neoplasms"]	0	[]	4	["Disgenet (Developmental disability)","CTD (Developmental disability)","CTD (Lung neoplasms)","CTD (Schizophrenia)"]
ERGIC3	2	["Developmental disability","Lung neoplasms"]	0	[]	2	["Disgenet (Developmental disability)","CTD (Lung neoplasms)"]

Diseases Linked via Similar Genes

Intellectual developmental disorder Linked via 1 of 5 related genesNAA15 Neurodevelopmental disorder Linked via 1 of 5 related genesNAA15 Non-specific syndromic intellectual disability Linked via 1 of 5 related genesNAA15 Breast cancer Linked via 1 of 5 related genesARHGEF5 Ovarian cancer Linked via 1 of 5 related genesARHGEF5

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Intellectual developmental disorder	1	["NAA15"]
Neurodevelopmental disorder	1	["NAA15"]
Non-specific syndromic intellectual disability	1	["NAA15"]
Breast cancer	1	["ARHGEF5"]
Ovarian cancer	1	["ARHGEF5"]