Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	6923
Gene name	Elongin B
Gene symbol	ELOB
Synonyms (NCBI Gene)	SIIITCEB2
Chromosome	16
Chromosome location	16p13.3
Summary	This gene encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymera

13 Show/Hide all (13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT643911	hsa-miR-216b-5p	HITS-CLIP	23824327
MIRT643910	hsa-miR-1910-3p	HITS-CLIP	23824327
MIRT643909	hsa-miR-6511a-5p	HITS-CLIP	23824327
MIRT643908	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT643907	hsa-miR-4514	HITS-CLIP	23824327
MIRT643906	hsa-miR-4692	HITS-CLIP	23824327
MIRT643905	hsa-miR-4645-5p	HITS-CLIP	23824327
MIRT643904	hsa-miR-4673	HITS-CLIP	23824327
MIRT643903	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT643902	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT643901	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT643900	hsa-miR-4771	HITS-CLIP	23824327
MIRT643899	hsa-miR-4753-3p	HITS-CLIP	23824327

23 Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	IEA
GO:0001222	Function	Transcription corepressor binding	IPI	7660122
GO:0005515	Function	Protein binding	IPI	10205047, 12004076, 12050673, 12149480, 15590694, 16189514, 20211142, 21119685, 21516116, 22190034, 22510880, 23401859, 25416956, 26906416, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006367	Process	Transcription initiation at RNA polymerase II promoter	IDA	7660122
GO:0006368	Process	Transcription elongation by RNA polymerase II	IEA
GO:0006368	Process	Transcription elongation by RNA polymerase II	TAS	7660129
GO:0016567	Process	Protein ubiquitination	IEA
GO:0030891	Component	VCB complex	IBA
GO:0030891	Component	VCB complex	IEA
GO:0031462	Component	Cul2-RING ubiquitin ligase complex	IDA	17636018
GO:0031466	Component	Cul5-RING ubiquitin ligase complex	IDA	17636018, 21980433, 23837592, 25505247, 31387940, 32513959, 33268465, 34857742, 35512830, 37816714, 38418882
GO:0031466	Component	Cul5-RING ubiquitin ligase complex	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IDA	17636018
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	ISS
GO:0065003	Process	Protein-containing complex assembly	TAS	7660129
GO:0070449	Component	Elongin complex	IBA
GO:0070449	Component	Elongin complex	IDA	7660122
GO:0070449	Component	Elongin complex	IEA
GO:0140958	Process	Target-directed miRNA degradation	IMP	33184237

MIM	HGNC	e!Ensembl
600787	11619	ENSG00000103363

Q15370

Protein name

Elongin-B (EloB) (Elongin 18 kDa subunit) (RNA polymerase II transcription factor SIII subunit B) (SIII p18) (Transcription elongation factor B polypeptide 2)

Protein function

SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity i

PDB

1LM8 , 1LQB , 1VCB , 2C9W , 2IZV , 2JZ3 , 2MA9 , 3DCG , 3ZKJ , 3ZNG , 3ZRC , 3ZRF , 3ZTC , 3ZTD , 3ZUN , 4AJY , 4AWJ , 4B95 , 4B9K , 4BKS , 4BKT , 4N9F , 4W9C , 4W9D , 4W9E , 4W9F , 4W9G , 4W9H , 4W9I , 4W9J , 4W9K , 4W9L , 4WQO , 5BO4 , 5LLI , 5N4W , 5NVV , 5NVW , 5NVX , 5NVY , 5NVZ , 5NW0 , 5NW1 , 5NW2 , 5T35 , 6BVB , 6C5X , 6FMI , 6FMJ , 6FMK , 6GFX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00240	ubiquitin	4 → 67	Ubiquitin family	Domain

Sequence

MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC
GFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ

Sequence length

118

Interactions

View interactions

KEGG Pathway	Reactome Pathway
HIF-1 signaling pathway	Formation of RNA Pol II elongation complex
Ubiquitin mediated proteolysis	Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
Human immunodeficiency virus 1 infection	Vif-mediated degradation of APOBEC3G
Pathways in cancer	RNA Polymerase II Pre-transcription Events
Renal cell carcinoma	TP53 Regulates Transcription of DNA Repair Genes
	RNA Polymerase II Transcription Elongation
	Neddylation
	Antigen processing: Ubiquitination & Proteasome degradation

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
ELOC	[]	11	["HIF-1 signaling pathway","Ubiquitin mediated proteolysis","Human immunodeficiency virus 1 infection","Renal cell carcinoma","Neddylation","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha","Vif-mediated degradation of APOBEC3G"]	[]
CUL2	[]	5	["HIF-1 signaling pathway","Ubiquitin mediated proteolysis","Renal cell carcinoma","Neddylation","Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha"]	[]
VHL	[]	5	["HIF-1 signaling pathway","Ubiquitin mediated proteolysis","Renal cell carcinoma","Neddylation","Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha"]	[]
ELOA3D	[]	4	["Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation"]	[]
ELOA3	[]	4	["Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation"]	[]

ELOB (elongin B)

Save This Analysis