ELOA2 (elongin A2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 51224
Gene name Elongin A2
Gene symbol ELOA2
Synonyms (NCBI Gene)
HsT832TCEB3BTCEB3L
Chromosome 18
Chromosome location 18q21.1
Summary This gene encodes the transcriptionally active subunit of the SIII (or elongin) transcription elongation factor complex, which also includes two regulatory subunits, elongins B and C. This complex acts to increase the rate of RNA chain elongation by RNA p
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 32296183, 32814053
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IEA
GO:0005654 Component Nucleoplasm TAS
GO:0006355 Process Regulation of DNA-templated transcription IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
609522 30771 ENSG00000206181
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8IYF1
Protein name Elongin-A2 (EloA2) (RNA polymerase II transcription factor SIII subunit A2) (Transcription elongation factor B polypeptide 3B)
Protein function SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A2 is transcriptionally active but its transcription activity
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06881 Elongin_A 544 → 642 RNA polymerase II transcription factor SIII (Elongin) subunit A Family
PF08711 Med26 29 → 77 TFIIS helical bundle-like domain Domain
Tissue specificity TISSUE SPECIFICITY: Specifically expressed in testis. {ECO:0000269|PubMed:10692460}.
Sequence 
MAAGSTTLHAVEKLQVRLATKTEPKKLEKYLQKLSALPMTADILAETGIRKTVKRLRKHQ
HVGDFARDLAARWKKLVLVDRNTRPGPQDPEESASRQRFGEALQDQEKAWGFPENATAPR
SPSHSPEHRRTARRTPPGQQRPHPRSHSREPRAERKCPRIAPADSGRYRASPTRTAPLRM
PEGPEPAAPGKQPGRGHTHAAQGGPLLCPGCQGQPQGKAVVSHSKGHKSSRQEKRPLCAQ
GDWHSPTLIREKSCGACLREETPRMPSWASARDRQPSDFKTDKEGGQAGSGQRVPALEEA
PDSHQKRPQHSHSNKKRPSLDGRDPGNGTHGLSPEEKEQLSNDRETQEGKPPTAHLDRTS
VSSLSEVEEVDMAEEFEQPTLSCEKYLTYDQLRKQKKKTGKSATTALGDKQRKANESKGT
RESWDSAKKLPPVQESQSERLQAAGADSAGPKTVPSHVFSELWDLSEAWMQANYDPLSDS
DSMTSQAKPEALSSPKFREEAAFPGRRVNAKMPVYSGSRPACQLQVPTLRQQCAQVLRNN
PDALSDVGEVPYWVLEPVLEGWRPDQLYRRKKDNHALVRETDELRRNHCFQDFKEEKPQE
NKTWREQYLRLPDAPEQRLRVMTTNIRSARGNNPNGREAKMICFKSVAKTPYDTSRRQEK
SAGDADPENGEIKPASKPAGSSHTPSSQSSSGGGRDSSSSILRWLPEKRANPCLSSSNEH
AAPAAKTRKQAAKKVAPLMAKAIRDYKRRFSRR
Sequence length 753
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Formation of RNA Pol II elongation complex
RNA Polymerase II Pre-transcription Events
TP53 Regulates Transcription of DNA Repair Genes
RNA Polymerase II Transcription Elongation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
Prostate cancer Uncertain significance ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Colorectal Carcinoma Colorectal Cancer UNIPROT_DG
★★★★★
★☆☆☆☆
Found in Text Mining only
Sort by:
ELOA3D 4 shared pathwaysFormation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation Related via 4 shared pathways including Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events. ELOA3 4 shared pathwaysFormation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation Related via 4 shared pathways including Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events. ELOA 4 shared pathwaysFormation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation Related via 4 shared pathways including Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events. ELOA3B 4 shared pathwaysFormation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation Related via 4 shared pathways including Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events. SUPT16H 4 shared pathwaysFormation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation Related via 4 shared pathways including Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events.
Eczema Linked via 1 of 5 related genesELOA Inflammatory skin disease Linked via 1 of 5 related genesELOA Psoriasis Linked via 1 of 5 related genesELOA 14q11.2 microduplication syndrome Linked via 1 of 5 related genesSUPT16H Neurodevelopmental disorder Linked via 1 of 5 related genesSUPT16H