ELOA (elongin A)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 6924
• Gene name: Elongin A
• Gene symbol: ELOA
• Synonyms (NCBI Gene): ELOA1, SIII, SIII p110, TCEB3, TCEB3A
• Chromosome: 1
• Chromosome location: 1p36.11
• Summary: This gene encodes the protein elongin A, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymera

miRNA Show/Hide all (40)

miRTarBase ID	miRNA	Experiments	Reference
MIRT561471	hsa-miR-3646	PAR-CLIP	20371350
MIRT272814	hsa-miR-1252-3p	PAR-CLIP	20371350
MIRT561470	hsa-miR-4760-3p	PAR-CLIP	20371350
MIRT561469	hsa-miR-5196-3p	PAR-CLIP	20371350
MIRT561468	hsa-miR-4793-5p	PAR-CLIP	20371350
MIRT272816	hsa-miR-4786-5p	PAR-CLIP	20371350
MIRT561467	hsa-miR-769-5p	PAR-CLIP	20371350
MIRT272815	hsa-miR-3671	PAR-CLIP	20371350
MIRT272812	hsa-miR-607	PAR-CLIP	20371350
MIRT546345	hsa-miR-587	PAR-CLIP	20371350
MIRT561466	hsa-miR-4677-3p	PAR-CLIP	20371350
MIRT561471	hsa-miR-3646	PAR-CLIP	20371350
MIRT272814	hsa-miR-1252-3p	PAR-CLIP	20371350
MIRT561470	hsa-miR-4760-3p	PAR-CLIP	20371350
MIRT561469	hsa-miR-5196-3p	PAR-CLIP	20371350
MIRT561468	hsa-miR-4793-5p	PAR-CLIP	20371350
MIRT272816	hsa-miR-4786-5p	PAR-CLIP	20371350
MIRT561467	hsa-miR-769-5p	PAR-CLIP	20371350
MIRT272815	hsa-miR-3671	PAR-CLIP	20371350
MIRT272812	hsa-miR-607	PAR-CLIP	20371350
MIRT561466	hsa-miR-4677-3p	PAR-CLIP	20371350
MIRT561471	hsa-miR-3646	PAR-CLIP	20371350
MIRT272814	hsa-miR-1252-3p	PAR-CLIP	20371350
MIRT561470	hsa-miR-4760-3p	PAR-CLIP	20371350
MIRT561469	hsa-miR-5196-3p	PAR-CLIP	20371350
MIRT561468	hsa-miR-4793-5p	PAR-CLIP	20371350
MIRT272816	hsa-miR-4786-5p	PAR-CLIP	20371350
MIRT561467	hsa-miR-769-5p	PAR-CLIP	20371350
MIRT272815	hsa-miR-3671	PAR-CLIP	20371350
MIRT272812	hsa-miR-607	PAR-CLIP	20371350
MIRT561466	hsa-miR-4677-3p	PAR-CLIP	20371350
MIRT186260	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT186259	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT186265	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT186261	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT186264	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT186263	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT186262	hsa-miR-125b-2-3p	PAR-CLIP	21572407
MIRT546346	hsa-miR-585-5p	PAR-CLIP	21572407
MIRT546345	hsa-miR-587	PAR-CLIP	21572407

Gene ontology (GO) Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 36217029
GO:0005615	Component	Extracellular space	HDA	22664934
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	7660129
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006367	Process	Transcription initiation at RNA polymerase II promoter	IDA	7660122
GO:0006368	Process	Transcription elongation by RNA polymerase II	IEA
GO:0070449	Component	Elongin complex	IDA	7660122
GO:0070449	Component	Elongin complex	IEA
GO:0090734	Component	Site of DNA damage	ISS

Other IDs

• MIM: 600786
• HGNC: 11620
• e!Ensembl: ENSG00000011007

Protein

• UniProt ID: Q14241
• Protein name: Elongin-A (EloA) (Elongin 110 kDa subunit) (RNA polymerase II transcription factor SIII subunit A1) (SIII p110) (Transcription elongation factor B polypeptide 3)
• Protein function: SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity i
• PDB: 4HFX , 6ZUZ , 8OEV , 8OEW , 8OF0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06881	Elongin_A	592 → 690	RNA polymerase II transcription factor SIII (Elongin) subunit A	Family
  PF08711	Med26	51 → 102	TFIIS helical bundle-like domain	Domain

• Sequence:

  MHGGRSCGPRTRREPSSGEEAAPVTAMAAESALQVVEKLQARLAANPDPKKLLKYLKKLS
  TLPITVDILAETGVGKTVNSLRKHEHVGSFARDLVAQWKKLVPVERNAEPDEQDFEKSNS
  RKRPRDALQKEEEMEGDYQETWKATGSRSYSPDHRQKKHRKLSELERPHKVSHGHERRDE
  RKRCHRMSPTYSSDPESSDYGHVQSPPSCTSPHQMYVDHYRSLEEDQEPIVSHQKPGKGH
  SNAFQDRLGASQERHLGEPHGKGVVSQNKEHKSSHKDKRPVDAKSDEKASVVSREKSHKA
  LSKEENRRPPSGDNAREKPPSSGVKKEKDREGSSLKKKCLPPSEAASDNHLKKPKHRDPE
  KAKLDKSKQGLDSFDTGKGAGDLLPKVKEKGSNNLKTPEGKVKTNLDRKSLGSLPKVEET
  DMEDEFEQPTMSFESYLSYDQPRKKKKKIVKTSATALGDKGLKKNDSKSTGKNLDSVQKL
  PKVNKTKSEKPAGADLAKLRKVPDVLPVLPDLPLPAIQANYRPLPSLELISSFQPKRKAF
  SSPQEEEEAGFTGRRMNSKMQVYSGSKCAYLPKMMTLHQQCIRVLKNNIDSIFEVGGVPY
  SVLEPVLERCTPDQLYRIEEYNHVLIEETDQLWKVHCHRDFKEERPEEYESWREMYLRLQ
  DAREQRLRVLTKNIQFAHANKPKGRQAKMAFVNSVAKPPRDVRRRQEKFGTGGAAVPEKI
  KIKPAPYPMGSSHASASSISFNPSPEEPAYDGPSTSSAHLAPVVSSTVSYDPRKPTVKKI
  APMMAKTIKAFKNRFSRR

• Sequence length: 798

Pathways

Reactome Pathway

Formation of RNA Pol II elongation complex

RNA Polymerase II Pre-transcription Events

TP53 Regulates Transcription of DNA Repair Genes

RNA Polymerase II Transcription Elongation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ATOPIC ECZEMA	—	GWAS catalog	25574825	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY SKIN DISEASE	—	GWAS catalog	25574825	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	25574825	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (14)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	9931330		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	30809972		★☆☆☆☆ Found in Text Mining only
Brugada Syndrome (disorder)	Brugada Syndrome	BEFREE	29608225		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36376892	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	9931330		★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	31677940		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	34400640	Associate	★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	BEFREE	9931330		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	21887344	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31677940, 9516832, 9931330		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	9931330		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	GWASCAT_DG	25574825		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tachycardia, Ventricular	Ventricular tachycardia	BEFREE	29608225		★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	9931330		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

ELOA3D 4 shared pathwaysFormation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation Related via 4 shared pathways including Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events. ELOA3 4 shared pathwaysFormation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation Related via 4 shared pathways including Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events. ELOA2 4 shared pathwaysFormation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation Related via 4 shared pathways including Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events. ELOA3B 4 shared pathwaysFormation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation Related via 4 shared pathways including Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events. SUPT16H 4 shared pathwaysFormation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation Related via 4 shared pathways including Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
ELOA3D	0	[]	4	["Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation"]	0	[]
ELOA3	0	[]	4	["Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation"]	0	[]
ELOA2	0	[]	4	["Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation"]	0	[]
ELOA3B	0	[]	4	["Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation"]	0	[]
SUPT16H	0	[]	4	["Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation"]	0	[]

Diseases Linked via Similar Genes

14q11.2 microduplication syndrome Linked via 1 of 5 related genesSUPT16H Neurodevelopmental disorder Linked via 1 of 5 related genesSUPT16H Conotruncal cardiac defect Linked via 1 of 5 related genesSUPT16H Dextrocardia Linked via 1 of 5 related genesSUPT16H Non-specific syndromic intellectual disability Linked via 1 of 5 related genesSUPT16H

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
14q11.2 microduplication syndrome	1	["SUPT16H"]
Neurodevelopmental disorder	1	["SUPT16H"]
Conotruncal cardiac defect	1	["SUPT16H"]
Dextrocardia	1	["SUPT16H"]
Non-specific syndromic intellectual disability	1	["SUPT16H"]