Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	8669
Gene name	Eukaryotic translation initiation factor 3 subunit J
Gene symbol	EIF3J
Synonyms (NCBI Gene)	EIF3S1eIF3-alphaeIF3-p35
Chromosome	15
Chromosome location	15q21.1
Summary	This gene encodes a core subunit of the eukaryotic initiation factor 3 complex, which participates in the initiation of translation by aiding in the recruitment of protein and mRNA components to the 40S ribosome. There are pseudogenes for this gene on chr

246 Show/Hide all (246)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003932	hsa-let-7e-5p	Luciferase reporter assay	15131085
MIRT020659	hsa-miR-155-5p	Proteomics	18668040
MIRT027570	hsa-miR-98-5p	Microarray	19088304
MIRT003932	hsa-let-7e-5p	Reporter assay	15131085
MIRT044772	hsa-miR-320a	CLASH	23622248
MIRT957605	hsa-miR-1183	CLIP-seq
MIRT957606	hsa-miR-1244	CLIP-seq
MIRT957607	hsa-miR-1248	CLIP-seq
MIRT957608	hsa-miR-1277	CLIP-seq
MIRT957609	hsa-miR-129-5p	CLIP-seq
MIRT957610	hsa-miR-134	CLIP-seq
MIRT957611	hsa-miR-137	CLIP-seq
MIRT957612	hsa-miR-138	CLIP-seq
MIRT957613	hsa-miR-142-5p	CLIP-seq
MIRT957614	hsa-miR-146a	CLIP-seq
MIRT957615	hsa-miR-146b-5p	CLIP-seq
MIRT957616	hsa-miR-199a-3p	CLIP-seq
MIRT957617	hsa-miR-199b-3p	CLIP-seq
MIRT957618	hsa-miR-202	CLIP-seq
MIRT957619	hsa-miR-2053	CLIP-seq
MIRT957620	hsa-miR-299-5p	CLIP-seq
MIRT957621	hsa-miR-3118	CLIP-seq
MIRT957622	hsa-miR-3123	CLIP-seq
MIRT957623	hsa-miR-3125	CLIP-seq
MIRT957624	hsa-miR-3129-5p	CLIP-seq
MIRT957625	hsa-miR-3143	CLIP-seq
MIRT957626	hsa-miR-3144-3p	CLIP-seq
MIRT957627	hsa-miR-3173-3p	CLIP-seq
MIRT957628	hsa-miR-320b	CLIP-seq
MIRT957629	hsa-miR-320c	CLIP-seq
MIRT957630	hsa-miR-320d	CLIP-seq
MIRT957631	hsa-miR-340	CLIP-seq
MIRT957632	hsa-miR-34b	CLIP-seq
MIRT957633	hsa-miR-3591-5p	CLIP-seq
MIRT957634	hsa-miR-3606	CLIP-seq
MIRT957635	hsa-miR-3622a-3p	CLIP-seq
MIRT957636	hsa-miR-3622b-3p	CLIP-seq
MIRT957637	hsa-miR-3688-3p	CLIP-seq
MIRT957638	hsa-miR-3691-3p	CLIP-seq
MIRT957639	hsa-miR-3692	CLIP-seq
MIRT957640	hsa-miR-3714	CLIP-seq
MIRT957641	hsa-miR-371-5p	CLIP-seq
MIRT957642	hsa-miR-371b-5p	CLIP-seq
MIRT957643	hsa-miR-3907	CLIP-seq
MIRT957644	hsa-miR-3916	CLIP-seq
MIRT957645	hsa-miR-3921	CLIP-seq
MIRT957646	hsa-miR-3925-5p	CLIP-seq
MIRT957647	hsa-miR-3973	CLIP-seq
MIRT957648	hsa-miR-3978	CLIP-seq
MIRT957649	hsa-miR-411	CLIP-seq
MIRT957650	hsa-miR-412	CLIP-seq
MIRT957651	hsa-miR-425	CLIP-seq
MIRT957652	hsa-miR-4251	CLIP-seq
MIRT957653	hsa-miR-4274	CLIP-seq
MIRT957654	hsa-miR-4293	CLIP-seq
MIRT957655	hsa-miR-4305	CLIP-seq
MIRT957656	hsa-miR-4307	CLIP-seq
MIRT957657	hsa-miR-4325	CLIP-seq
MIRT957658	hsa-miR-4329	CLIP-seq
MIRT957659	hsa-miR-4429	CLIP-seq
MIRT957660	hsa-miR-4464	CLIP-seq
MIRT957661	hsa-miR-4476	CLIP-seq
MIRT957662	hsa-miR-4477a	CLIP-seq
MIRT957663	hsa-miR-4490	CLIP-seq
MIRT957664	hsa-miR-451b	CLIP-seq
MIRT957665	hsa-miR-4639-3p	CLIP-seq
MIRT957666	hsa-miR-4653-5p	CLIP-seq
MIRT957667	hsa-miR-4663	CLIP-seq
MIRT957668	hsa-miR-4684-3p	CLIP-seq
MIRT957669	hsa-miR-4703-3p	CLIP-seq
MIRT957670	hsa-miR-4714-5p	CLIP-seq
MIRT957671	hsa-miR-4724-3p	CLIP-seq
MIRT957672	hsa-miR-4724-5p	CLIP-seq
MIRT957673	hsa-miR-4729	CLIP-seq
MIRT957674	hsa-miR-4731-3p	CLIP-seq
MIRT957675	hsa-miR-4742-3p	CLIP-seq
MIRT957676	hsa-miR-4748	CLIP-seq
MIRT957677	hsa-miR-4762-5p	CLIP-seq
MIRT957678	hsa-miR-4775	CLIP-seq
MIRT957679	hsa-miR-4778-3p	CLIP-seq
MIRT957680	hsa-miR-4790-3p	CLIP-seq
MIRT957681	hsa-miR-4801	CLIP-seq
MIRT957682	hsa-miR-4803	CLIP-seq
MIRT957683	hsa-miR-507	CLIP-seq
MIRT957684	hsa-miR-513b	CLIP-seq
MIRT957685	hsa-miR-513c	CLIP-seq
MIRT957686	hsa-miR-514b-5p	CLIP-seq
MIRT957687	hsa-miR-520g	CLIP-seq
MIRT957688	hsa-miR-520h	CLIP-seq
MIRT957689	hsa-miR-548g	CLIP-seq
MIRT957690	hsa-miR-548q	CLIP-seq
MIRT957691	hsa-miR-557	CLIP-seq
MIRT957692	hsa-miR-569	CLIP-seq
MIRT957693	hsa-miR-582-3p	CLIP-seq
MIRT957694	hsa-miR-584	CLIP-seq
MIRT957695	hsa-miR-590-3p	CLIP-seq
MIRT957696	hsa-miR-596	CLIP-seq
MIRT957697	hsa-miR-628-5p	CLIP-seq
MIRT957698	hsa-miR-875-5p	CLIP-seq
MIRT957699	hsa-miR-885-3p	CLIP-seq
MIRT957700	hsa-miR-889	CLIP-seq
MIRT957701	hsa-miR-891b	CLIP-seq
MIRT957702	hsa-miR-921	CLIP-seq
MIRT957703	hsa-miR-936	CLIP-seq
MIRT957618	hsa-miR-202	CLIP-seq
MIRT957627	hsa-miR-3173-3p	CLIP-seq
MIRT957672	hsa-miR-4724-5p	CLIP-seq
MIRT957675	hsa-miR-4742-3p	CLIP-seq
MIRT957680	hsa-miR-4790-3p	CLIP-seq
MIRT957694	hsa-miR-584	CLIP-seq
MIRT957605	hsa-miR-1183	CLIP-seq
MIRT957607	hsa-miR-1248	CLIP-seq
MIRT957619	hsa-miR-2053	CLIP-seq
MIRT957628	hsa-miR-320b	CLIP-seq
MIRT957629	hsa-miR-320c	CLIP-seq
MIRT957630	hsa-miR-320d	CLIP-seq
MIRT957632	hsa-miR-34b	CLIP-seq
MIRT957639	hsa-miR-3692	CLIP-seq
MIRT957641	hsa-miR-371-5p	CLIP-seq
MIRT957642	hsa-miR-371b-5p	CLIP-seq
MIRT1983716	hsa-miR-380	CLIP-seq
MIRT957647	hsa-miR-3973	CLIP-seq
MIRT957656	hsa-miR-4307	CLIP-seq
MIRT957657	hsa-miR-4325	CLIP-seq
MIRT957659	hsa-miR-4429	CLIP-seq
MIRT957662	hsa-miR-4477a	CLIP-seq
MIRT957671	hsa-miR-4724-3p	CLIP-seq
MIRT957672	hsa-miR-4724-5p	CLIP-seq
MIRT957675	hsa-miR-4742-3p	CLIP-seq
MIRT957677	hsa-miR-4762-5p	CLIP-seq
MIRT957678	hsa-miR-4775	CLIP-seq
MIRT957682	hsa-miR-4803	CLIP-seq
MIRT957685	hsa-miR-513c	CLIP-seq
MIRT957686	hsa-miR-514b-5p	CLIP-seq
MIRT957687	hsa-miR-520g	CLIP-seq
MIRT957688	hsa-miR-520h	CLIP-seq
MIRT957692	hsa-miR-569	CLIP-seq
MIRT957694	hsa-miR-584	CLIP-seq
MIRT2218988	hsa-miR-1179	CLIP-seq
MIRT2218989	hsa-miR-1224-3p	CLIP-seq
MIRT957606	hsa-miR-1244	CLIP-seq
MIRT957612	hsa-miR-138	CLIP-seq
MIRT2218990	hsa-miR-1470	CLIP-seq
MIRT957616	hsa-miR-199a-3p	CLIP-seq
MIRT957617	hsa-miR-199b-3p	CLIP-seq
MIRT2218991	hsa-miR-200b	CLIP-seq
MIRT2218992	hsa-miR-200c	CLIP-seq
MIRT957618	hsa-miR-202	CLIP-seq
MIRT2218993	hsa-miR-2052	CLIP-seq
MIRT957619	hsa-miR-2053	CLIP-seq
MIRT2218994	hsa-miR-219-5p	CLIP-seq
MIRT2218995	hsa-miR-3074-3p	CLIP-seq
MIRT2218996	hsa-miR-3128	CLIP-seq
MIRT957624	hsa-miR-3129-5p	CLIP-seq
MIRT2218997	hsa-miR-3140-3p	CLIP-seq
MIRT2218998	hsa-miR-3157-5p	CLIP-seq
MIRT2218999	hsa-miR-3163	CLIP-seq
MIRT957627	hsa-miR-3173-3p	CLIP-seq
MIRT957631	hsa-miR-340	CLIP-seq
MIRT957632	hsa-miR-34b	CLIP-seq
MIRT2219000	hsa-miR-361-3p	CLIP-seq
MIRT957635	hsa-miR-3622a-3p	CLIP-seq
MIRT957636	hsa-miR-3622b-3p	CLIP-seq
MIRT2219001	hsa-miR-3661	CLIP-seq
MIRT2219002	hsa-miR-3678-3p	CLIP-seq
MIRT2219003	hsa-miR-374c	CLIP-seq
MIRT957643	hsa-miR-3907	CLIP-seq
MIRT2219004	hsa-miR-3920	CLIP-seq
MIRT957645	hsa-miR-3921	CLIP-seq
MIRT957650	hsa-miR-412	CLIP-seq
MIRT957652	hsa-miR-4251	CLIP-seq
MIRT957653	hsa-miR-4274	CLIP-seq
MIRT2219005	hsa-miR-429	CLIP-seq
MIRT957654	hsa-miR-4293	CLIP-seq
MIRT957657	hsa-miR-4325	CLIP-seq
MIRT957658	hsa-miR-4329	CLIP-seq
MIRT2219006	hsa-miR-4445	CLIP-seq
MIRT2219007	hsa-miR-4446-5p	CLIP-seq
MIRT957660	hsa-miR-4464	CLIP-seq
MIRT2219008	hsa-miR-4470	CLIP-seq
MIRT2219009	hsa-miR-4473	CLIP-seq
MIRT957664	hsa-miR-451b	CLIP-seq
MIRT957665	hsa-miR-4639-3p	CLIP-seq
MIRT957666	hsa-miR-4653-5p	CLIP-seq
MIRT2219010	hsa-miR-4667-3p	CLIP-seq
MIRT957670	hsa-miR-4714-5p	CLIP-seq
MIRT957672	hsa-miR-4724-5p	CLIP-seq
MIRT957675	hsa-miR-4742-3p	CLIP-seq
MIRT957676	hsa-miR-4748	CLIP-seq
MIRT2219011	hsa-miR-4755-5p	CLIP-seq
MIRT2219012	hsa-miR-4762-3p	CLIP-seq
MIRT957679	hsa-miR-4778-3p	CLIP-seq
MIRT2219013	hsa-miR-4782-3p	CLIP-seq
MIRT957680	hsa-miR-4790-3p	CLIP-seq
MIRT2219014	hsa-miR-4793-3p	CLIP-seq
MIRT957682	hsa-miR-4803	CLIP-seq
MIRT2219015	hsa-miR-492	CLIP-seq
MIRT957683	hsa-miR-507	CLIP-seq
MIRT2219016	hsa-miR-508-3p	CLIP-seq
MIRT2219017	hsa-miR-512-3p	CLIP-seq
MIRT957684	hsa-miR-513b	CLIP-seq
MIRT2219018	hsa-miR-520f	CLIP-seq
MIRT957691	hsa-miR-557	CLIP-seq
MIRT957694	hsa-miR-584	CLIP-seq
MIRT957695	hsa-miR-590-3p	CLIP-seq
MIRT957696	hsa-miR-596	CLIP-seq
MIRT2219019	hsa-miR-631	CLIP-seq
MIRT2219020	hsa-miR-642a	CLIP-seq
MIRT2219021	hsa-miR-655	CLIP-seq
MIRT957699	hsa-miR-885-3p	CLIP-seq
MIRT957703	hsa-miR-936	CLIP-seq
MIRT957657	hsa-miR-4325	CLIP-seq
MIRT957637	hsa-miR-3688-3p	CLIP-seq
MIRT1983716	hsa-miR-380	CLIP-seq
MIRT957648	hsa-miR-3978	CLIP-seq
MIRT957606	hsa-miR-1244	CLIP-seq
MIRT957618	hsa-miR-202	CLIP-seq
MIRT2218993	hsa-miR-2052	CLIP-seq
MIRT957627	hsa-miR-3173-3p	CLIP-seq
MIRT2522303	hsa-miR-3545-3p	CLIP-seq
MIRT957660	hsa-miR-4464	CLIP-seq
MIRT957664	hsa-miR-451b	CLIP-seq
MIRT957668	hsa-miR-4684-3p	CLIP-seq
MIRT957672	hsa-miR-4724-5p	CLIP-seq
MIRT957675	hsa-miR-4742-3p	CLIP-seq
MIRT957676	hsa-miR-4748	CLIP-seq
MIRT957694	hsa-miR-584	CLIP-seq
MIRT957695	hsa-miR-590-3p	CLIP-seq
MIRT957699	hsa-miR-885-3p	CLIP-seq
MIRT957701	hsa-miR-891b	CLIP-seq
MIRT957606	hsa-miR-1244	CLIP-seq
MIRT957618	hsa-miR-202	CLIP-seq
MIRT2218993	hsa-miR-2052	CLIP-seq
MIRT957627	hsa-miR-3173-3p	CLIP-seq
MIRT2522303	hsa-miR-3545-3p	CLIP-seq
MIRT957643	hsa-miR-3907	CLIP-seq
MIRT957660	hsa-miR-4464	CLIP-seq
MIRT957664	hsa-miR-451b	CLIP-seq
MIRT957672	hsa-miR-4724-5p	CLIP-seq
MIRT957675	hsa-miR-4742-3p	CLIP-seq
MIRT957676	hsa-miR-4748	CLIP-seq
MIRT957680	hsa-miR-4790-3p	CLIP-seq
MIRT957694	hsa-miR-584	CLIP-seq
MIRT957695	hsa-miR-590-3p	CLIP-seq
MIRT957699	hsa-miR-885-3p	CLIP-seq
MIRT957701	hsa-miR-891b	CLIP-seq

19 Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	IEA
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	NAS	16920360
GO:0002183	Process	Cytoplasmic translational initiation	IEA
GO:0003743	Function	Translation initiation factor activity	IC	17322308, 18599441
GO:0003743	Function	Translation initiation factor activity	IEA
GO:0005515	Function	Protein binding	IPI	14688252, 16932749, 18628297, 22113938, 25852190, 32296183, 32707033, 32911434, 33961781, 35271311
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IBA
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IDA	17322308, 18599441
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IEA
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IPI	17322308
GO:0006412	Process	Translation	IEA
GO:0006413	Process	Translational initiation	IC	17322308, 18599441
GO:0006413	Process	Translational initiation	IEA
GO:0016282	Component	Eukaryotic 43S preinitiation complex	IEA
GO:0033290	Component	Eukaryotic 48S preinitiation complex	IEA
GO:0042802	Function	Identical protein binding	IPI	32296183

MIM	HGNC	e!Ensembl
603910	3270	ENSG00000104131

O75822

Protein name

Eukaryotic translation initiation factor 3 subunit J (eIF3j) (Eukaryotic translation initiation factor 3 subunit 1) (eIF-3-alpha) (eIF3 p35)

Protein function

Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed:25849773, PubMed:27462815). The eIF-3 complex associates with the 40S ribosome and fa

PDB

2KRB , 3BPJ , 6YBW , 6ZMW , 6ZVJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08597	eIF3_subunit	11 → 258	Translation initiation factor eIF3 subunit	Family

Sequence

MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKK
EEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRL
KKLQEESDLELAKETFGVNNAVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFL
EVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDL
ADYGGYDGGYVQDYEDFM

Sequence length

258

Interactions

View interactions

Reactome Pathway
L13a-mediated translational silencing of Ceruloplasmin expression
Translation initiation complex formation
Formation of a pool of free 40S subunits
Formation of the ternary complex, and subsequently, the 43S complex
Ribosomal scanning and start codon recognition
GTP hydrolysis and joining of the 60S ribosomal subunit

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
SPASTIC PARAPLEGIA	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPASTIC PARAPLEGIA 11, AUTOSOMAL RECESSIVE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (20)
Anemia	Anemia	Pubtator	25732572	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24789280, 31197975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30670911	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22804784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31709617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	26464640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28715695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25732572, 26213845, 28074905, 31197975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24386425, 28359406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22804784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22804784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	21625209, 23956056	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	25732572	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22804784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26213845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24386425	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27333287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	25732572	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	28359406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum Complementation Group C	Xeroderma pigmentosum	Pubtator	26213845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
EIF3M	[]	6	["L13a-mediated translational silencing of Ceruloplasmin expression","Translation initiation complex formation","Formation of a pool of free 40S subunits","Formation of the ternary complex, and subsequently, the 43S complex","Ribosomal scanning and start codon recognition","GTP hydrolysis and joining of the 60S ribosomal subunit"]	[]
EIF1AX	[]	6	["L13a-mediated translational silencing of Ceruloplasmin expression","Translation initiation complex formation","Formation of a pool of free 40S subunits","Formation of the ternary complex, and subsequently, the 43S complex","Ribosomal scanning and start codon recognition","GTP hydrolysis and joining of the 60S ribosomal subunit"]	[]
EIF3K	[]	6	["L13a-mediated translational silencing of Ceruloplasmin expression","Translation initiation complex formation","Formation of a pool of free 40S subunits","Formation of the ternary complex, and subsequently, the 43S complex","Ribosomal scanning and start codon recognition","GTP hydrolysis and joining of the 60S ribosomal subunit"]	[]
EIF3L	[]	6	["L13a-mediated translational silencing of Ceruloplasmin expression","Translation initiation complex formation","Formation of a pool of free 40S subunits","Formation of the ternary complex, and subsequently, the 43S complex","Ribosomal scanning and start codon recognition","GTP hydrolysis and joining of the 60S ribosomal subunit"]	[]
EIF3A	[]	6	["L13a-mediated translational silencing of Ceruloplasmin expression","Translation initiation complex formation","Formation of a pool of free 40S subunits","Formation of the ternary complex, and subsequently, the 43S complex","Ribosomal scanning and start codon recognition","GTP hydrolysis and joining of the 60S ribosomal subunit"]	[]

EIF3J (eukaryotic translation initiation factor 3 subunit J)

Bookmark This Gene