EIF3K (eukaryotic translation initiation factor 3 subunit K)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 27335
• Gene name: Eukaryotic translation initiation factor 3 subunit K
• Gene symbol: EIF3K
• Synonyms (NCBI Gene): ARG134, EIF3-p28, EIF3S12, HSPC029, M9, MSTP001, PLAC-24, PLAC24, PRO1474, PTD001
• Chromosome: 19
• Chromosome location: 19q13.2
• Summary: The 700-kD eukaryotic translation initiation factor-3 (eIF3) is the largest eIF and contains at least 12 subunits, including EIF2S12. eIF3 plays an essential role in translation by binding directly to the 40S ribosomal subunit and promoting formation of t

miRNA Show/Hide all (6)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016103	hsa-miR-421	Sequencing	20371350
MIRT031817	hsa-miR-16-5p	Proteomics	18668040
MIRT049261	hsa-miR-92a-3p	CLASH	23622248
MIRT037589	hsa-miR-744-5p	CLASH	23622248
MIRT957704	hsa-miR-4477a	CLIP-seq
MIRT957705	hsa-miR-505	CLIP-seq

Gene ontology (GO) Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	IEA
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	NAS	16920360
GO:0002183	Process	Cytoplasmic translational initiation	IEA
GO:0003723	Function	RNA binding	IEA
GO:0003743	Function	Translation initiation factor activity	IBA
GO:0003743	Function	Translation initiation factor activity	IC	17322308, 18599441
GO:0003743	Function	Translation initiation factor activity	IDA	17581632, 25849773
GO:0003743	Function	Translation initiation factor activity	IEA
GO:0003743	Function	Translation initiation factor activity	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 18599441, 18628297, 19748344, 21516116, 22190034, 23623729, 25416956, 27173435, 28514442, 32296183, 32814053, 33961781, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IBA
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IDA	17322308, 17581632, 18599441, 25849773
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IEA
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IPI	17322308
GO:0006412	Process	Translation	IEA
GO:0006413	Process	Translational initiation	IC	17322308, 18599441
GO:0006413	Process	Translational initiation	IDA	17581632
GO:0006413	Process	Translational initiation	IEA
GO:0006446	Process	Regulation of translational initiation	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016282	Component	Eukaryotic 43S preinitiation complex	IEA
GO:0033290	Component	Eukaryotic 48S preinitiation complex	IEA
GO:0043022	Function	Ribosome binding	IEA

Other IDs

• MIM: 609596
• HGNC: 24656
• e!Ensembl: ENSG00000178982

Protein

• UniProt ID: Q9UBQ5
• Protein name: Eukaryotic translation initiation factor 3 subunit K (eIF3k) (Eukaryotic translation initiation factor 3 subunit 12) (Muscle-specific gene M9 protein) (PLAC-24) (eIF-3 p25) (eIF-3 p28)
• Protein function: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed:17581632, PubMed:25849773, PubMed:27462815). The eIF-3 complex associates with the 40
• PDB: 1RZ4 , 3J8B , 3J8C , 6FEC , 6YBD , 6ZMW , 6ZON , 6ZP4 , 6ZVJ , 7A09 , 7QP6 , 7QP7 , 8OZ0 , 8PJ1 , 8PJ2 , 8PJ3 , 8PJ4 , 8PJ5 , 8PJ6 , 8PPL , 8RG0 , 8XXN , 9BLN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10075	CSN8_PSD8_EIF3K	61 → 200	CSN8/PSMD8/EIF3K family	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous, with the highest levels of expression in brain, testis and kidney. {ECO:0000269|PubMed:14519125}.
• Sequence:

  MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAF
  FQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQA
  LDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWS
  ADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ

• Sequence length: 218

Pathways

Reactome Pathway

L13a-mediated translational silencing of Ceruloplasmin expression

Translation initiation complex formation

Formation of a pool of free 40S subunits

Formation of the ternary complex, and subsequently, the 43S complex

Ribosomal scanning and start codon recognition

GTP hydrolysis and joining of the 60S ribosomal subunit

Related Genes

Sort by: Blended Diseases Pathways Evidence source

EIF3M 6 shared pathwaysL13a-mediated translational silencing of Ceruloplasmin expression, Translation initiation complex formation, Formation of a pool of free 40S subunits, Formation of the ternary complex, and subsequently, the 43S complex, Ribosomal scanning and start codon recognition, GTP hydrolysis and joining of the 60S ribosomal subunit Related via 6 shared pathways including L13a-mediated translational silencing of Ceruloplasmin expression, Translation initiation complex formation. EIF1AX 6 shared pathwaysL13a-mediated translational silencing of Ceruloplasmin expression, Translation initiation complex formation, Formation of a pool of free 40S subunits, Formation of the ternary complex, and subsequently, the 43S complex, Ribosomal scanning and start codon recognition, GTP hydrolysis and joining of the 60S ribosomal subunit Related via 6 shared pathways including L13a-mediated translational silencing of Ceruloplasmin expression, Translation initiation complex formation. EIF3L 6 shared pathwaysL13a-mediated translational silencing of Ceruloplasmin expression, Translation initiation complex formation, Formation of a pool of free 40S subunits, Formation of the ternary complex, and subsequently, the 43S complex, Ribosomal scanning and start codon recognition, GTP hydrolysis and joining of the 60S ribosomal subunit Related via 6 shared pathways including L13a-mediated translational silencing of Ceruloplasmin expression, Translation initiation complex formation. EIF3A 6 shared pathwaysL13a-mediated translational silencing of Ceruloplasmin expression, Translation initiation complex formation, Formation of a pool of free 40S subunits, Formation of the ternary complex, and subsequently, the 43S complex, Ribosomal scanning and start codon recognition, GTP hydrolysis and joining of the 60S ribosomal subunit Related via 6 shared pathways including L13a-mediated translational silencing of Ceruloplasmin expression, Translation initiation complex formation. EIF3B 6 shared pathwaysL13a-mediated translational silencing of Ceruloplasmin expression, Translation initiation complex formation, Formation of a pool of free 40S subunits, Formation of the ternary complex, and subsequently, the 43S complex, Ribosomal scanning and start codon recognition, GTP hydrolysis and joining of the 60S ribosomal subunit Related via 6 shared pathways including L13a-mediated translational silencing of Ceruloplasmin expression, Translation initiation complex formation.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
EIF3M	0	[]	6	["L13a-mediated translational silencing of Ceruloplasmin expression","Translation initiation complex formation","Formation of a pool of free 40S subunits","Formation of the ternary complex, and subsequently, the 43S complex","Ribosomal scanning and start codon recognition","GTP hydrolysis and joining of the 60S ribosomal subunit"]	0	[]
EIF1AX	0	[]	6	["L13a-mediated translational silencing of Ceruloplasmin expression","Translation initiation complex formation","Formation of a pool of free 40S subunits","Formation of the ternary complex, and subsequently, the 43S complex","Ribosomal scanning and start codon recognition","GTP hydrolysis and joining of the 60S ribosomal subunit"]	0	[]
EIF3L	0	[]	6	["L13a-mediated translational silencing of Ceruloplasmin expression","Translation initiation complex formation","Formation of a pool of free 40S subunits","Formation of the ternary complex, and subsequently, the 43S complex","Ribosomal scanning and start codon recognition","GTP hydrolysis and joining of the 60S ribosomal subunit"]	0	[]
EIF3A	0	[]	6	["L13a-mediated translational silencing of Ceruloplasmin expression","Translation initiation complex formation","Formation of a pool of free 40S subunits","Formation of the ternary complex, and subsequently, the 43S complex","Ribosomal scanning and start codon recognition","GTP hydrolysis and joining of the 60S ribosomal subunit"]	0	[]
EIF3B	0	[]	6	["L13a-mediated translational silencing of Ceruloplasmin expression","Translation initiation complex formation","Formation of a pool of free 40S subunits","Formation of the ternary complex, and subsequently, the 43S complex","Ribosomal scanning and start codon recognition","GTP hydrolysis and joining of the 60S ribosomal subunit"]	0	[]

Diseases Linked via Similar Genes

Color vision deficiency Linked via 2 of 5 related genesEIF3M, EIF3B Major depressive disorder Linked via 1 of 5 related genesEIF3M Metabolic syndrome Linked via 1 of 5 related genesEIF3M Diabetes mellitus type 2 Linked via 1 of 5 related genesEIF3M Uterine fibroid Linked via 1 of 5 related genesEIF3M

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Color vision deficiency	2	["EIF3M","EIF3B"]
Major depressive disorder	1	["EIF3M"]
Metabolic syndrome	1	["EIF3M"]
Diabetes mellitus type 2	1	["EIF3M"]
Uterine fibroid	1	["EIF3M"]