EIF3C (eukaryotic translation initiation factor 3 subunit C)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 8663
• Gene name: Eukaryotic translation initiation factor 3 subunit C
• Gene symbol: EIF3C
• Synonyms (NCBI Gene): EIF3CL, EIF3S8, eIF3-p110
• Chromosome: 16
• Chromosome location: 16p11.2

miRNA Show/Hide all (115)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020535	hsa-miR-155-5p	Proteomics	18668040
MIRT031415	hsa-miR-16-5p	Proteomics	18668040
MIRT052417	hsa-let-7a-5p	CLASH	23622248
MIRT052417	hsa-let-7a-5p	CLASH	23622248
MIRT051944	hsa-let-7b-5p	CLASH	23622248
MIRT051944	hsa-let-7b-5p	CLASH	23622248
MIRT051944	hsa-let-7b-5p	CLASH	23622248
MIRT051775	hsa-let-7c-5p	CLASH	23622248
MIRT051357	hsa-let-7f-5p	CLASH	23622248
MIRT049027	hsa-miR-92a-3p	CLASH	23622248
MIRT049027	hsa-miR-92a-3p	CLASH	23622248
MIRT049027	hsa-miR-92a-3p	CLASH	23622248
MIRT049027	hsa-miR-92a-3p	CLASH	23622248
MIRT047297	hsa-miR-181b-5p	CLASH	23622248
MIRT045450	hsa-miR-149-5p	CLASH	23622248
MIRT045450	hsa-miR-149-5p	CLASH	23622248
MIRT044937	hsa-miR-186-5p	CLASH	23622248
MIRT044937	hsa-miR-186-5p	CLASH	23622248
MIRT044779	hsa-miR-320a	CLASH	23622248
MIRT044100	hsa-miR-361-5p	CLASH	23622248
MIRT042529	hsa-miR-423-3p	CLASH	23622248
MIRT039669	hsa-miR-615-3p	CLASH	23622248
MIRT039669	hsa-miR-615-3p	CLASH	23622248
MIRT039309	hsa-miR-425-5p	CLASH	23622248
MIRT038530	hsa-miR-99b-3p	CLASH	23622248
MIRT036996	hsa-miR-877-3p	CLASH	23622248
MIRT036996	hsa-miR-877-3p	CLASH	23622248
MIRT036476	hsa-miR-1226-3p	CLASH	23622248
MIRT036164	hsa-miR-320c	CLASH	23622248
MIRT458086	hsa-miR-3937	PAR-CLIP	23592263
MIRT458085	hsa-miR-3136-3p	PAR-CLIP	23592263
MIRT458084	hsa-miR-7155-3p	PAR-CLIP	23592263
MIRT458085	hsa-miR-3136-3p	PAR-CLIP	26701625
MIRT458086	hsa-miR-3937	PAR-CLIP	26701625
MIRT458084	hsa-miR-7155-3p	PAR-CLIP	26701625
MIRT458086	hsa-miR-3937	PAR-CLIP	23592263
MIRT458085	hsa-miR-3136-3p	PAR-CLIP	23592263
MIRT458084	hsa-miR-7155-3p	PAR-CLIP	23592263
MIRT957519	hsa-miR-1193	CLIP-seq
MIRT957520	hsa-miR-1273g	CLIP-seq
MIRT957521	hsa-miR-134	CLIP-seq
MIRT957522	hsa-miR-185	CLIP-seq
MIRT957523	hsa-miR-299-5p	CLIP-seq
MIRT957524	hsa-miR-3117-3p	CLIP-seq
MIRT957525	hsa-miR-3118	CLIP-seq
MIRT957526	hsa-miR-3136-5p	CLIP-seq
MIRT957527	hsa-miR-3169	CLIP-seq
MIRT957528	hsa-miR-3591-5p	CLIP-seq
MIRT957529	hsa-miR-3606	CLIP-seq
MIRT957530	hsa-miR-4261	CLIP-seq
MIRT957531	hsa-miR-4306	CLIP-seq
MIRT957532	hsa-miR-4439	CLIP-seq
MIRT957533	hsa-miR-4513	CLIP-seq
MIRT957534	hsa-miR-4644	CLIP-seq
MIRT957535	hsa-miR-4759	CLIP-seq
MIRT957536	hsa-miR-4761-5p	CLIP-seq
MIRT957537	hsa-miR-4797-5p	CLIP-seq
MIRT957538	hsa-miR-651	CLIP-seq
MIRT957539	hsa-miR-759	CLIP-seq
MIRT957540	hsa-miR-921	CLIP-seq
MIRT957519	hsa-miR-1193	CLIP-seq
MIRT957520	hsa-miR-1273g	CLIP-seq
MIRT957523	hsa-miR-299-5p	CLIP-seq
MIRT957524	hsa-miR-3117-3p	CLIP-seq
MIRT957527	hsa-miR-3169	CLIP-seq
MIRT957530	hsa-miR-4261	CLIP-seq
MIRT957535	hsa-miR-4759	CLIP-seq
MIRT957536	hsa-miR-4761-5p	CLIP-seq
MIRT957537	hsa-miR-4797-5p	CLIP-seq
MIRT957538	hsa-miR-651	CLIP-seq
MIRT957539	hsa-miR-759	CLIP-seq
MIRT957519	hsa-miR-1193	CLIP-seq
MIRT957520	hsa-miR-1273g	CLIP-seq
MIRT957521	hsa-miR-134	CLIP-seq
MIRT957523	hsa-miR-299-5p	CLIP-seq
MIRT957524	hsa-miR-3117-3p	CLIP-seq
MIRT957525	hsa-miR-3118	CLIP-seq
MIRT957526	hsa-miR-3136-5p	CLIP-seq
MIRT957527	hsa-miR-3169	CLIP-seq
MIRT957528	hsa-miR-3591-5p	CLIP-seq
MIRT957529	hsa-miR-3606	CLIP-seq
MIRT957532	hsa-miR-4439	CLIP-seq
MIRT957533	hsa-miR-4513	CLIP-seq
MIRT957535	hsa-miR-4759	CLIP-seq
MIRT957536	hsa-miR-4761-5p	CLIP-seq
MIRT957538	hsa-miR-651	CLIP-seq
MIRT957540	hsa-miR-921	CLIP-seq
MIRT957519	hsa-miR-1193	CLIP-seq
MIRT957520	hsa-miR-1273g	CLIP-seq
MIRT957522	hsa-miR-185	CLIP-seq
MIRT957523	hsa-miR-299-5p	CLIP-seq
MIRT957524	hsa-miR-3117-3p	CLIP-seq
MIRT957527	hsa-miR-3169	CLIP-seq
MIRT957530	hsa-miR-4261	CLIP-seq
MIRT957531	hsa-miR-4306	CLIP-seq
MIRT957534	hsa-miR-4644	CLIP-seq
MIRT957535	hsa-miR-4759	CLIP-seq
MIRT957536	hsa-miR-4761-5p	CLIP-seq
MIRT957537	hsa-miR-4797-5p	CLIP-seq
MIRT957538	hsa-miR-651	CLIP-seq
MIRT957539	hsa-miR-759	CLIP-seq
MIRT957519	hsa-miR-1193	CLIP-seq
MIRT957520	hsa-miR-1273g	CLIP-seq
MIRT957522	hsa-miR-185	CLIP-seq
MIRT957523	hsa-miR-299-5p	CLIP-seq
MIRT957524	hsa-miR-3117-3p	CLIP-seq
MIRT957527	hsa-miR-3169	CLIP-seq
MIRT957530	hsa-miR-4261	CLIP-seq
MIRT957531	hsa-miR-4306	CLIP-seq
MIRT957534	hsa-miR-4644	CLIP-seq
MIRT957535	hsa-miR-4759	CLIP-seq
MIRT957536	hsa-miR-4761-5p	CLIP-seq
MIRT957537	hsa-miR-4797-5p	CLIP-seq
MIRT957538	hsa-miR-651	CLIP-seq
MIRT957539	hsa-miR-759	CLIP-seq

Gene ontology (GO) Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	IEA
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	NAS	16920360
GO:0002183	Process	Cytoplasmic translational initiation	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IEA
GO:0003743	Function	Translation initiation factor activity	IBA
GO:0003743	Function	Translation initiation factor activity	IC	17322308, 18599441
GO:0003743	Function	Translation initiation factor activity	IDA	17581632, 25849773
GO:0003743	Function	Translation initiation factor activity	IEA
GO:0005515	Function	Protein binding	IPI	10504338, 18599441, 18628297, 22190034, 22323517, 23623729, 28514442, 29426014, 29987188, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IBA
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IDA	17322308, 17581632, 18599441, 25849773
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IEA
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IPI	17322308
GO:0006412	Process	Translation	IEA
GO:0006413	Process	Translational initiation	IBA
GO:0006413	Process	Translational initiation	IC	17322308, 18599441
GO:0006413	Process	Translational initiation	IDA	17581632
GO:0006413	Process	Translational initiation	IEA
GO:0016282	Component	Eukaryotic 43S preinitiation complex	IEA
GO:0031369	Function	Translation initiation factor binding	IBA
GO:0031369	Function	Translation initiation factor binding	IEA
GO:0033290	Component	Eukaryotic 48S preinitiation complex	IEA
GO:0043022	Function	Ribosome binding	IDA	8995409
GO:0045727	Process	Positive regulation of translation	IPI	24092755

Other IDs

• MIM: 603916
• HGNC: 3279
• e!Ensembl: ENSG00000184110

Protein

• UniProt ID: Q99613
• Protein name: Eukaryotic translation initiation factor 3 subunit C (eIF3c) (Eukaryotic translation initiation factor 3 subunit 8) (eIF3 p110)
• Protein function: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed:17581632, PubMed:25849773, PubMed:27462815). The eIF-3 complex associates with the 40
• PDB: 3J8B , 3J8C , 6YBD , 6YBW , 6ZMW , 6ZON , 6ZP4 , 7A09 , 7QP6 , 7QP7 , 8OZ0 , 8PJ1 , 8PJ2 , 8PJ3 , 8PJ4 , 8PJ5 , 8PJ6 , 8PPL , 8RG0 , 8XXN , 9BLN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01399	PCI	712 → 846	PCI domain	Domain
  PF05470	eIF-3c_N	29 → 705	Eukaryotic translation initiation factor 3 subunit 8 N-terminus	Family

• Sequence:

  MSRFFTTGSDSESESSLSGEELVTKPVGGNYGKQPLLLSEDEEDTKRVVRSAKDKRFEEL
  TNLIRTIRNAMKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYIRILADLEDYLNEL
  WEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFESHITSYKQNPEQSADEDAEKNEEDSEG
  SSDEDEDEDGVSAATFLKKKSEAPSGESRKFLKKMDDEDEDSEDSEDDEDWDTGSTSSDS
  DSEEEEGKQTALASRFLKKAPTTDEDKKAAEKKREDKAKKKHDRKSKRLDEEEEDNEGGE
  WERVRGGVPLVKEKPKMFAKGTEITHAVVIKKLNEILQARGKKGTDRAAQIELLQLLVQI
  AAENNLGEGVIVKIKFNIIASLYDYNPNLATYMKPEMWGKCLDCINELMDILFANPNIFV
  GENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVC
  AIIERVQRYLEEKGTTEEVCRIYLLRILHTYYKFDYKAHQRQLTPPEGSSKSEQDQAENE
  GEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQH
  ADPPVQILYNRTMVQLGICAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNQ
  EQEKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRV
  GERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTMLV
  RKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQ
  TVVMHRTEPTAQQNLALQLAEKLGSLVENNERVFDHKQGTYGGYFRDQKDGYRKNEGYMR
  RGGYRQQQSQTAY

• Sequence length: 913

Pathways

Reactome Pathway

L13a-mediated translational silencing of Ceruloplasmin expression

Translation initiation complex formation

Formation of a pool of free 40S subunits

Formation of the ternary complex, and subsequently, the 43S complex

Ribosomal scanning and start codon recognition

GTP hydrolysis and joining of the 60S ribosomal subunit

Related Genes

Sort by: Blended Diseases Pathways Evidence source

EIF3M 6 shared pathwaysL13a-mediated translational silencing of Ceruloplasmin expression, Translation initiation complex formation, Formation of a pool of free 40S subunits, Formation of the ternary complex, and subsequently, the 43S complex, Ribosomal scanning and start codon recognition, GTP hydrolysis and joining of the 60S ribosomal subunit Related via 6 shared pathways including L13a-mediated translational silencing of Ceruloplasmin expression, Translation initiation complex formation. EIF1AX 6 shared pathwaysL13a-mediated translational silencing of Ceruloplasmin expression, Translation initiation complex formation, Formation of a pool of free 40S subunits, Formation of the ternary complex, and subsequently, the 43S complex, Ribosomal scanning and start codon recognition, GTP hydrolysis and joining of the 60S ribosomal subunit Related via 6 shared pathways including L13a-mediated translational silencing of Ceruloplasmin expression, Translation initiation complex formation. EIF3K 6 shared pathwaysL13a-mediated translational silencing of Ceruloplasmin expression, Translation initiation complex formation, Formation of a pool of free 40S subunits, Formation of the ternary complex, and subsequently, the 43S complex, Ribosomal scanning and start codon recognition, GTP hydrolysis and joining of the 60S ribosomal subunit Related via 6 shared pathways including L13a-mediated translational silencing of Ceruloplasmin expression, Translation initiation complex formation. EIF3L 6 shared pathwaysL13a-mediated translational silencing of Ceruloplasmin expression, Translation initiation complex formation, Formation of a pool of free 40S subunits, Formation of the ternary complex, and subsequently, the 43S complex, Ribosomal scanning and start codon recognition, GTP hydrolysis and joining of the 60S ribosomal subunit Related via 6 shared pathways including L13a-mediated translational silencing of Ceruloplasmin expression, Translation initiation complex formation. EIF3A 6 shared pathwaysL13a-mediated translational silencing of Ceruloplasmin expression, Translation initiation complex formation, Formation of a pool of free 40S subunits, Formation of the ternary complex, and subsequently, the 43S complex, Ribosomal scanning and start codon recognition, GTP hydrolysis and joining of the 60S ribosomal subunit Related via 6 shared pathways including L13a-mediated translational silencing of Ceruloplasmin expression, Translation initiation complex formation.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
EIF3M	0	[]	6	["L13a-mediated translational silencing of Ceruloplasmin expression","Translation initiation complex formation","Formation of a pool of free 40S subunits","Formation of the ternary complex, and subsequently, the 43S complex","Ribosomal scanning and start codon recognition","GTP hydrolysis and joining of the 60S ribosomal subunit"]	0	[]
EIF1AX	0	[]	6	["L13a-mediated translational silencing of Ceruloplasmin expression","Translation initiation complex formation","Formation of a pool of free 40S subunits","Formation of the ternary complex, and subsequently, the 43S complex","Ribosomal scanning and start codon recognition","GTP hydrolysis and joining of the 60S ribosomal subunit"]	0	[]
EIF3K	0	[]	6	["L13a-mediated translational silencing of Ceruloplasmin expression","Translation initiation complex formation","Formation of a pool of free 40S subunits","Formation of the ternary complex, and subsequently, the 43S complex","Ribosomal scanning and start codon recognition","GTP hydrolysis and joining of the 60S ribosomal subunit"]	0	[]
EIF3L	0	[]	6	["L13a-mediated translational silencing of Ceruloplasmin expression","Translation initiation complex formation","Formation of a pool of free 40S subunits","Formation of the ternary complex, and subsequently, the 43S complex","Ribosomal scanning and start codon recognition","GTP hydrolysis and joining of the 60S ribosomal subunit"]	0	[]
EIF3A	0	[]	6	["L13a-mediated translational silencing of Ceruloplasmin expression","Translation initiation complex formation","Formation of a pool of free 40S subunits","Formation of the ternary complex, and subsequently, the 43S complex","Ribosomal scanning and start codon recognition","GTP hydrolysis and joining of the 60S ribosomal subunit"]	0	[]

Diseases Linked via Similar Genes

Color vision deficiency Linked via 1 of 5 related genesEIF3M Major depressive disorder Linked via 1 of 5 related genesEIF3M Metabolic syndrome Linked via 1 of 5 related genesEIF3M Diabetes mellitus type 2 Linked via 1 of 5 related genesEIF3M Uterine fibroid Linked via 1 of 5 related genesEIF3M

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Color vision deficiency	1	["EIF3M"]
Major depressive disorder	1	["EIF3M"]
Metabolic syndrome	1	["EIF3M"]
Diabetes mellitus type 2	1	["EIF3M"]
Uterine fibroid	1	["EIF3M"]