Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	10589
Gene name	DR1 associated protein 1
Gene symbol	DRAP1
Synonyms (NCBI Gene)	NC2-alpha
Chromosome	11
Chromosome location	11q13.1
Summary	Transcriptional repression is a general mechanism for regulating transcriptional initiation in organisms ranging from yeast to humans. Accurate initiation of transcription from eukaryotic protein-encoding genes requires the assembly of a large multiprote

miRTarBase ID	miRNA	Experiments	Reference
MIRT020517	hsa-miR-155-5p	Proteomics	18668040
MIRT023515	hsa-miR-1-3p	Proteomics	18668040
MIRT038135	hsa-miR-423-5p	CLASH	23622248

19 Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	8670811
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS	8608938
GO:0001046	Function	Core promoter sequence-specific DNA binding	IBA
GO:0001091	Function	RNA polymerase II general transcription initiation factor binding	IDA	8608938
GO:0001091	Function	RNA polymerase II general transcription initiation factor binding	IPI	8670811
GO:0003677	Function	DNA binding	IDA	8670811
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 16713569, 18692475, 21516116, 25416956, 27107012, 29997244, 31467278, 31515488, 32296183, 32814053, 33961781, 34819669, 37398436
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IBA
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IBA
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IDA	8670811
GO:0017025	Function	TBP-class protein binding	IPI	8670811
GO:0017054	Component	Negative cofactor 2 complex	IBA
GO:0042802	Function	Identical protein binding	IPI	25416956, 27107012
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IDA	8670811

MIM	HGNC	e!Ensembl
602289	3019	ENSG00000175550

Q14919

Protein name

Dr1-associated corepressor (Dr1-associated protein 1) (Negative cofactor 2-alpha) (NC2-alpha)

Protein function

The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the

PDB

1JFI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00808	CBFD_NFYB_HMF	10 → 74	Histone-like transcription factor (CBF/NF-Y) and archaeal histone	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Highly expressed in adult testis, heart, skeletal muscle, pancreas and brain, and in fetal brain, liver and kidney. {ECO:0000269|PubMed:8608938, ECO:0000269|PubMed:8670811}.

Sequence

MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSR
NAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRK
NGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFA
STLPLPPAPPGPSAPDEEDEEDYDS

Sequence length

205

Interactions

View interactions

Reactome Pathway
Signaling by NODAL
Signaling by Activin

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (6)
BREAST CANCER	—	GWAS catalog	29059683	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	29059683	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	31578528	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	22535842	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	31604244	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	37386247	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (7)
Breast Neoplasms	Breast neoplasm	Pubtator	34493366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35812454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	28588707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	12477712	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	CTD_human_DG	22535842		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34588774	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sveinsson Chorioretinal Atrophy	Sveinsson chorioretinal atrophy	Pubtator	34493366	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

DRAP1 (DR1 associated protein 1)

Bookmark This Gene