Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	4089
Gene name	SMAD family member 4
Gene symbol	SMAD4
Synonyms (NCBI Gene)	DPC4JIPMADH4MYHRS
Chromosome	18
Chromosome location	18q21.2
Summary	This gene encodes a member of the Smad family of signal transduction proteins. Smad proteins are phosphorylated and activated by transmembrane serine-threonine receptor kinases in response to transforming growth factor (TGF)-beta signaling. The product of

178

Show/Hide all (178)

SNP ID	Visualize variation	Clinical significance	Consequence
rs7238500	A>G	Likely-benign, conflicting-interpretations-of-pathogenicity, uncertain-significance	Missense variant, coding sequence variant
rs80338963	C>A,G,T	Not-provided, pathogenic, likely-pathogenic	Coding sequence variant, missense variant
rs80338964	C>T	Pathogenic	Stop gained, coding sequence variant
rs80338965	CAGA>-	Pathogenic	Coding sequence variant, frameshift variant
rs121912576	G>T	Pathogenic	Stop gained, coding sequence variant
rs121912577	C>G,T	Likely-benign, pathogenic	Synonymous variant, stop gained, coding sequence variant
rs121912578	G>C	Pathogenic	Missense variant, coding sequence variant
rs121912579	A>T	Pathogenic	Stop gained, coding sequence variant
rs121912580	G>A,C,T	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs121912581	G>A	Pathogenic, not-provided	Missense variant, coding sequence variant
rs138386557	A>G	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs140743238	C>A,G,T	Uncertain-significance, likely-benign, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs149755320	A>G	Conflicting-interpretations-of-pathogenicity, likely-benign, benign	Missense variant, coding sequence variant
rs200772603	G>A	Conflicting-interpretations-of-pathogenicity, likely-benign, uncertain-significance	Intron variant
rs281875320	A>G	Pathogenic, not-provided	Missense variant, coding sequence variant
rs281875321	T>C	Pathogenic	Missense variant, coding sequence variant
rs281875322	A>G	Pathogenic	Missense variant, coding sequence variant
rs281875324	A>C,G	Pathogenic, likely-pathogenic, not-provided	Missense variant, coding sequence variant
rs377767323	G>A	Pathogenic	Coding sequence variant, stop gained
rs377767324	->AT	Pathogenic	Frameshift variant, coding sequence variant
rs377767325	->TGTCTGT	Pathogenic	Frameshift variant, coding sequence variant
rs377767326	C>A,T	Pathogenic, likely-benign	Synonymous variant, coding sequence variant, stop gained
rs377767327	A>G	Uncertain-significance, pathogenic	Intron variant
rs377767328	TC>-	Pathogenic	Frameshift variant, coding sequence variant
rs377767329	T>A,G	Pathogenic	Coding sequence variant, stop gained
rs377767330	GTCCACTGAAGG>-	Pathogenic	Inframe deletion, coding sequence variant
rs377767331	C>G	Pathogenic	Coding sequence variant, stop gained
rs377767332	C>T	Pathogenic	Coding sequence variant, stop gained
rs377767333	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs377767334	->G	Pathogenic	Frameshift variant, coding sequence variant
rs377767335	->GCCC	Pathogenic	Frameshift variant, coding sequence variant
rs377767336	AC>-	Pathogenic	Frameshift variant, coding sequence variant
rs377767338	->GCAT	Pathogenic	Frameshift variant, coding sequence variant
rs377767339	T>C	Uncertain-significance, pathogenic	Missense variant, coding sequence variant
rs377767340	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs377767341	->T	Pathogenic	Frameshift variant, coding sequence variant
rs377767342	G>A	Pathogenic	Missense variant, coding sequence variant
rs377767343	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs377767344	GT>-	Pathogenic	Frameshift variant, coding sequence variant
rs377767345	G>A	Pathogenic	Missense variant, coding sequence variant
rs377767346	A>C,G	Uncertain-significance, pathogenic	Missense variant, coding sequence variant
rs377767347	G>A,C,T	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs377767348	T>C	Pathogenic	Missense variant, coding sequence variant
rs377767349	GTT>-	Pathogenic	Inframe deletion, coding sequence variant
rs377767350	T>G	Pathogenic	Missense variant, coding sequence variant
rs377767351	TC>-	Pathogenic	Frameshift variant, coding sequence variant
rs377767352	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs377767354	G>A	Pathogenic	Splice donor variant
rs377767355	T>A,C,G	Uncertain-significance, pathogenic	Missense variant, coding sequence variant
rs377767356	G>A	Pathogenic	Missense variant, coding sequence variant
rs377767357	G>A	Pathogenic	Coding sequence variant, stop gained
rs377767358	A>-	Pathogenic	Frameshift variant, coding sequence variant
rs377767359	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs377767360	C>T	Pathogenic	Coding sequence variant, stop gained
rs377767361	C>G,T	Uncertain-significance, pathogenic	Missense variant, coding sequence variant, stop gained
rs377767362	AGCAGCAGGCGGCTACTGCACAA>-	Pathogenic	Frameshift variant, coding sequence variant
rs377767363	CACA>-	Pathogenic	Frameshift variant, coding sequence variant
rs377767364	->CCCT	Pathogenic	Frameshift variant, coding sequence variant
rs377767365	GGCCCAGGATCAGTAGGTGGAATAG>-	Pathogenic	Frameshift variant, coding sequence variant
rs377767366	C>-	Pathogenic	Coding sequence variant, stop gained
rs377767367	G>T	Pathogenic	Missense variant, coding sequence variant
rs377767368	A>C	Pathogenic	Missense variant, coding sequence variant
rs377767369	T>A,G	Uncertain-significance, pathogenic	Missense variant, coding sequence variant
rs377767370	G>A	Pathogenic	Coding sequence variant, stop gained
rs377767371	G>T	Pathogenic	Missense variant, coding sequence variant
rs377767372	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs377767373	AG>-,AGAGAG	Likely-pathogenic, pathogenic	Frameshift variant, coding sequence variant
rs377767374	CC>-	Pathogenic	Frameshift variant, coding sequence variant
rs377767375	G>T	Pathogenic	Missense variant, coding sequence variant
rs377767376	->A	Pathogenic	Frameshift variant, coding sequence variant
rs377767377	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs377767378	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs377767379	CC>T	Pathogenic	Frameshift variant, coding sequence variant
rs377767380	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs377767381	C>G,T	Uncertain-significance, pathogenic	Missense variant, coding sequence variant
rs377767382	T>C,G	Pathogenic	Missense variant, coding sequence variant
rs377767383	C>T	Pathogenic	Coding sequence variant, stop gained
rs377767384	->T	Pathogenic	Frameshift variant, coding sequence variant
rs377767385	GAAGTACTTCATAC>-	Pathogenic	Frameshift variant, coding sequence variant
rs377767386	G>A	Pathogenic	Splice donor variant
rs377767387	G>A	Pathogenic	Splice donor variant
rs397518413	C>T	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs483352871	A>-	Pathogenic	Intron variant
rs587780124	GCGGCTACTGCACAAGCTGCAGCAG>-	Pathogenic	Coding sequence variant, frameshift variant
rs587781359	C>T	Pathogenic	Stop gained, coding sequence variant
rs587781618	G>A,T	Pathogenic, likely-pathogenic	Splice donor variant
rs587782209	AG>CC	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Coding sequence variant, missense variant
rs587783060	->A	Pathogenic	Coding sequence variant, frameshift variant
rs727504151	T>AAATATGAAC	Pathogenic	Stop gained, inframe indel, coding sequence variant
rs730881952	AG>-	Pathogenic	Coding sequence variant, frameshift variant
rs730881954	C>A,G,T	Pathogenic	Stop gained, synonymous variant, coding sequence variant
rs730881956	->CG	Pathogenic	Coding sequence variant, frameshift variant
rs730881957	GA>-	Pathogenic	Coding sequence variant, frameshift variant
rs746084369	C>G,T	Pathogenic	Stop gained, synonymous variant, coding sequence variant
rs757971589	G>A,C	Conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign	Intron variant
rs773615487	T>A,C	Likely-benign, conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs779069779	C>A,G,T	Likely-benign, pathogenic	Synonymous variant, stop gained, coding sequence variant
rs786201200	->A	Pathogenic	Frameshift variant, coding sequence variant
rs786203560	A>-,AA	Pathogenic	Frameshift variant, coding sequence variant
rs786204125	->GCTACTGCACAAGCTGCAGCAGCTGCCC	Pathogenic	Frameshift variant, coding sequence variant
rs786205514	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs863224400	C>G,T	Likely-benign, likely-pathogenic	Synonymous variant, stop gained, coding sequence variant
rs863224507	T>A	Pathogenic	Stop gained, coding sequence variant
rs864622252	TT>-,T	Likely-pathogenic	Frameshift variant, coding sequence variant
rs869312781	CCCCATCCCG>-	Pathogenic	Coding sequence variant, frameshift variant
rs876658694	C>T	Pathogenic	Coding sequence variant, stop gained
rs876660079	G>A	Pathogenic	Coding sequence variant, stop gained
rs876660150	->TT	Pathogenic	Coding sequence variant, frameshift variant
rs876660556	G>A,C	Likely-pathogenic	Coding sequence variant, missense variant
rs876660720	AGGCGGCTACTGCACAAGCTGCAGCAGC>-,AGGCGGCTACTGCACAAGCTGCAGCAGCAGGCGGCTACTGCACAAGCTGCAGCAGC	Pathogenic, likely-pathogenic	Coding sequence variant, frameshift variant
rs878854765	->T	Pathogenic	Coding sequence variant, stop gained
rs878854769	G>A	Pathogenic	Coding sequence variant, stop gained
rs956212866	A>C	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Intron variant
rs1057519739	G>A,C	Pathogenic	Missense variant, coding sequence variant
rs1057519740	C>A	Pathogenic	Missense variant, coding sequence variant
rs1057519741	G>T	Pathogenic	Missense variant, coding sequence variant
rs1057519962	G>A,T	Likely-pathogenic	Missense variant, coding sequence variant
rs1060500733	C>T	Pathogenic	Stop gained, coding sequence variant
rs1060500734	A>-	Pathogenic	Frameshift variant, coding sequence variant
rs1060500738	T>C	Likely-pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs1060500739	AAGGA>-	Likely-pathogenic, pathogenic	Frameshift variant, coding sequence variant
rs1060500740	T>C	Likely-pathogenic	Splice donor variant
rs1060500742	GGCCTCAG>-	Pathogenic	Frameshift variant, coding sequence variant
rs1060500744	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs1064793271	TCAGCCTGCCAGTATACTGGGGG>-	Pathogenic	Splice acceptor variant, coding sequence variant
rs1064795175	T>C	Conflicting-interpretations-of-pathogenicity	Intron variant
rs1064796471	AT>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1295343500	A>G,T	Conflicting-interpretations-of-pathogenicity, likely-benign	Intron variant
rs1316902116	C>G,T	Pathogenic, likely-benign	Synonymous variant, coding sequence variant, stop gained
rs1449334786	C>G,T	Pathogenic	Stop gained, missense variant, coding sequence variant
rs1555685142	A>G	Likely-pathogenic	Splice acceptor variant
rs1555685149	G>A,C	Pathogenic, likely-pathogenic	Splice acceptor variant
rs1555685156	AT>-	Pathogenic	Frameshift variant, coding sequence variant
rs1555685159	G>A,T	Uncertain-significance, likely-pathogenic	Missense variant, coding sequence variant
rs1555685248	T>C	Likely-pathogenic	Splice donor variant
rs1555685624	C>G	Pathogenic	Stop gained, coding sequence variant
rs1555685925	A>-	Pathogenic	Frameshift variant, coding sequence variant
rs1555685974	->CATTACTG	Pathogenic	Splice donor variant, coding sequence variant
rs1555685978	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs1555686070	G>A	Likely-pathogenic	Splice acceptor variant
rs1555686071	G>A	Pathogenic	Stop gained, coding sequence variant
rs1555686086	G>-	Likely-pathogenic	Splice donor variant, coding sequence variant
rs1555686469	T>-	Pathogenic	Frameshift variant, coding sequence variant
rs1555686503	AG>-	Pathogenic	Frameshift variant, coding sequence variant
rs1555686506	A>-	Pathogenic	Frameshift variant, coding sequence variant
rs1555686594	G>A	Pathogenic	Splice acceptor variant
rs1555686600	TG>-	Pathogenic	Stop gained, coding sequence variant
rs1555686604	->T	Pathogenic	Frameshift variant, coding sequence variant
rs1555686608	CA>-	Pathogenic	Frameshift variant, coding sequence variant
rs1555686610	CTT>-	Pathogenic	Stop gained, inframe indel, coding sequence variant
rs1555686616	->A	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1555686624	T>C	Pathogenic	Splice donor variant
rs1555687377	G>A	Likely-pathogenic	Splice acceptor variant
rs1555687378	C>T	Pathogenic	Stop gained, coding sequence variant
rs1555687386	->CCCT	Pathogenic	Frameshift variant, coding sequence variant
rs1555687387	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs1555687388	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs1555687572	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs1555687599	->TA	Pathogenic	Frameshift variant, coding sequence variant
rs1555687605	A>G	Likely-pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs1568206107	G>A	Likely-pathogenic	Splice donor variant
rs1568206602	->C	Pathogenic	Coding sequence variant, frameshift variant
rs1568208715	A>C	Likely-pathogenic	Splice acceptor variant
rs1568211187	AGCAGCAGGCGGCTACTGCACAAGC>-	Pathogenic	Coding sequence variant, frameshift variant
rs1568211588	G>A	Pathogenic	Coding sequence variant, stop gained
rs1599181081	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs1599181251	C>T	Pathogenic	Coding sequence variant, stop gained
rs1599182571	C>G	Pathogenic	Coding sequence variant, stop gained
rs1599182586	CC>-	Pathogenic	Coding sequence variant, frameshift variant
rs1599182906	T>-	Pathogenic	Coding sequence variant, frameshift variant
rs1599195400	C>G	Pathogenic	Coding sequence variant, stop gained
rs1599195433	->A	Pathogenic	Coding sequence variant, frameshift variant
rs1599195489	->C	Pathogenic	Coding sequence variant, frameshift variant
rs1599196995	G>A	Pathogenic	Coding sequence variant, stop gained
rs1599197105	GA>-	Pathogenic	Coding sequence variant, frameshift variant
rs1599204042	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs1599204121	C>T	Pathogenic	Coding sequence variant, stop gained
rs1599204140	C>T	Pathogenic	Coding sequence variant, stop gained

1103

Show/Hide all (1103)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004736	hsa-miR-18a-5p	ImmunoblotLuciferase reporter assayMicroarrayqRT-PCRWestern blot	20940405
MIRT004118	hsa-miR-483-3p	Luciferase reporter assayqRT-PCRWestern blot	21112326
MIRT004118	hsa-miR-483-3p	Luciferase reporter assayqRT-PCRWestern blot	21112326
MIRT004118	hsa-miR-483-3p	Luciferase reporter assayqRT-PCRWestern blot	21112326
MIRT004118	hsa-miR-483-3p	Luciferase reporter assayqRT-PCRWestern blot	21112326
MIRT004118	hsa-miR-483-3p	Luciferase reporter assayqRT-PCRWestern blot	21112326
MIRT003803	hsa-miR-26a-5p	Western blot	20857419
MIRT005629	hsa-miR-17-5p	Luciferase reporter assayMicroarray	20940405
MIRT005630	hsa-miR-19a-3p	Luciferase reporter assayMicroarray	20940405
MIRT005631	hsa-miR-20a-5p	Microarray	20940405
MIRT005632	hsa-miR-92a-3p	Microarray	20940405
MIRT006038	hsa-miR-203a-3p	ImmunoblotIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	21159887
MIRT006190	hsa-miR-421	Luciferase reporter assayqRT-PCRWestern blot	21352803
MIRT006209	hsa-miR-146a-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	22507670
MIRT006209	hsa-miR-146a-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	22507670
MIRT006038	hsa-miR-203a-3p	ImmunoblotIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	21159887
MIRT006190	hsa-miR-421	Luciferase reporter assayqRT-PCRWestern blot	21352803
MIRT006209	hsa-miR-146a-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	22507670
MIRT006209	hsa-miR-146a-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	22507670
MIRT006527	hsa-miR-224-5p	Luciferase reporter assayWestern blot	20118412
MIRT006527	hsa-miR-224-5p	Luciferase reporter assayWestern blot	20118412
MIRT006527	hsa-miR-224-5p	Luciferase reporter assayWestern blot	20118412
MIRT006527	hsa-miR-224-5p	Luciferase reporter assayWestern blot	20118412
MIRT006527	hsa-miR-224-5p	Luciferase reporter assayWestern blot	20118412
MIRT006527	hsa-miR-224-5p	Luciferase reporter assayWestern blot	20118412
MIRT006527	hsa-miR-224-5p	Luciferase reporter assayWestern blot	20118412
MIRT006038	hsa-miR-203a-3p	ImmunoblotIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	21159887
MIRT006190	hsa-miR-421	Luciferase reporter assayqRT-PCRWestern blot	21352803
MIRT006209	hsa-miR-146a-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	22507670
MIRT006209	hsa-miR-146a-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	22507670
MIRT006527	hsa-miR-224-5p	Luciferase reporter assayWestern blot	20118412
MIRT006527	hsa-miR-224-5p	Luciferase reporter assayWestern blot	20118412
MIRT006527	hsa-miR-224-5p	Luciferase reporter assayWestern blot	20118412
MIRT006527	hsa-miR-224-5p	Luciferase reporter assayWestern blot	20118412
MIRT006527	hsa-miR-224-5p	Luciferase reporter assayWestern blot	20118412
MIRT006527	hsa-miR-224-5p	Luciferase reporter assayWestern blot	20118412
MIRT006527	hsa-miR-224-5p	Luciferase reporter assayWestern blot	20118412
MIRT006209	hsa-miR-146a-5p	Luciferase reporter assayqRT-PCRWestern blot	21968601
MIRT006809	hsa-miR-125a-5p	Luciferase reporter assayWestern blot	22357933
MIRT006810	hsa-miR-125b-5p	Luciferase reporter assayWestern blot	22357933
MIRT003803	hsa-miR-26a-5p	Luciferase reporter assay	23028144
MIRT007013	hsa-miR-199a-5p	Luciferase reporter assay	22821565
MIRT007013	hsa-miR-199a-5p	Luciferase reporter assay	22819820
MIRT007013	hsa-miR-199a-5p	Luciferase reporter assay	22819820
MIRT007013	hsa-miR-199a-5p	Luciferase reporter assay	22819820
MIRT007144	hsa-miR-130a-3p	qRT-PCR	23418453
MIRT007144	hsa-miR-130a-3p	Luciferase reporter assay	23393589
MIRT007250	hsa-miR-301a-3p	Luciferase reporter assay	23393589
MIRT007251	hsa-miR-454-3p	Luciferase reporter assay	23393589
MIRT007251	hsa-miR-454-3p	Luciferase reporter assay	23393589
MIRT007306	hsa-miR-182-5p	Luciferase reporter assay	23226455
MIRT007306	hsa-miR-182-5p	Luciferase reporter assay	23226455
MIRT020189	hsa-miR-130b-3p	Sequencing	20371350
MIRT020774	hsa-miR-155-5p	Western blot	21036908
MIRT021160	hsa-miR-186-5p	Sequencing	20371350
MIRT028004	hsa-miR-93-5p	Sequencing	20371350
MIRT031156	hsa-miR-19b-3p	Sequencing	20371350
MIRT006209	hsa-miR-146a-5p	Luciferase reporter assayqRT-PCRWestern blot	22020746
MIRT053029	hsa-miR-204-5p	Luciferase reporter assayWestern blot	23221074
MIRT007251	hsa-miR-454-3p	FlowLuciferase reporter assayqRT-PCRWestern blot	24685242
MIRT006527	hsa-miR-224-5p	qRT-PCRWestern blot	23922662
MIRT006527	hsa-miR-224-5p	qRT-PCRWestern blot	23922662
MIRT006527	hsa-miR-224-5p	qRT-PCRWestern blot	23922662
MIRT006527	hsa-miR-224-5p	qRT-PCRWestern blot	23922662
MIRT053328	hsa-miR-1260b	Luciferase reporter assayqRT-PCRWestern blot	23591200
MIRT053378	hsa-miR-205-5p	Luciferase reporter assayqRT-PCRWestern blot	23800974
MIRT053460	hsa-miR-452-5p	Microarray	23807165
MIRT006209	hsa-miR-146a-5p	Luciferase reporter assayqRT-PCRWestern blot	22020746
MIRT007144	hsa-miR-130a-3p	Microarray	22942087
MIRT053653	hsa-miR-145-5p	Microarray	22942087
MIRT005629	hsa-miR-17-5p	Luciferase reporter assay	24220575
MIRT005630	hsa-miR-19a-3p	Luciferase reporter assay	24220575
MIRT020189	hsa-miR-130b-3p	Luciferase reporter assay	24220575
MIRT006209	hsa-miR-146a-5p	Luciferase reporter assayWestern blotqRT-PCR	24939082
MIRT054867	hsa-miR-183-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23538390
MIRT006209	hsa-miR-146a-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23832538
MIRT006209	hsa-miR-146a-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23832538
MIRT005630	hsa-miR-19a-3p	Luciferase reporter assay	23998804
MIRT031156	hsa-miR-19b-3p	Luciferase reporter assay	23998804
MIRT053328	hsa-miR-1260b	Luciferase reporter assayWestern blot	24504368
MIRT005630	hsa-miR-19a-3p	Luciferase reporter assay	23998804
MIRT031156	hsa-miR-19b-3p	Luciferase reporter assay	23998804
MIRT053328	hsa-miR-1260b	Luciferase reporter assayWestern blot	24504368
MIRT653377	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT653376	hsa-miR-6072	HITS-CLIP	23824327
MIRT653375	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT653374	hsa-miR-6731-3p	HITS-CLIP	23824327
MIRT653373	hsa-miR-513a-5p	HITS-CLIP	23824327
MIRT653372	hsa-miR-27a-3p	HITS-CLIP	23824327
MIRT653371	hsa-miR-27b-3p	HITS-CLIP	23824327
MIRT653370	hsa-miR-4799-5p	HITS-CLIP	23824327
MIRT653369	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT080233	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT080244	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT080237	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT080224	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT080225	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT005629	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT005631	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT080226	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT080230	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT080228	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT028004	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT080231	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT080229	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT080227	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT508708	hsa-miR-888-5p	PAR-CLIP	20371350
MIRT007144	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT020189	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT007250	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT080234	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT080240	hsa-miR-3666	PAR-CLIP	20371350
MIRT080239	hsa-miR-4295	PAR-CLIP	20371350
MIRT007251	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT508707	hsa-miR-371b-5p	PAR-CLIP	20371350
MIRT508706	hsa-miR-373-5p	PAR-CLIP	20371350
MIRT508705	hsa-miR-616-5p	PAR-CLIP	20371350
MIRT508704	hsa-miR-302a-5p	PAR-CLIP	20371350
MIRT080241	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT080235	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT080236	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT080238	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT508703	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT005630	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT031156	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT080243	hsa-miR-548aw	PAR-CLIP	20371350
MIRT346455	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT080233	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT080244	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT080237	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT080224	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT080225	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT005629	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT005631	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT080226	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT080230	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT080228	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT028004	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT080231	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT080229	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT080227	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT508708	hsa-miR-888-5p	PAR-CLIP	20371350
MIRT007144	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT020189	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT007250	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT080234	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT080240	hsa-miR-3666	PAR-CLIP	20371350
MIRT080239	hsa-miR-4295	PAR-CLIP	20371350
MIRT007251	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT508707	hsa-miR-371b-5p	PAR-CLIP	20371350
MIRT508706	hsa-miR-373-5p	PAR-CLIP	20371350
MIRT508705	hsa-miR-616-5p	PAR-CLIP	20371350
MIRT508704	hsa-miR-302a-5p	PAR-CLIP	20371350
MIRT080241	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT080235	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT080236	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT080238	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT508703	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT346455	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT005630	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT031156	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT080243	hsa-miR-548aw	PAR-CLIP	20371350
MIRT198920	hsa-miR-34c-5p	PAR-CLIP	20371350
MIRT198918	hsa-miR-34a-5p	PAR-CLIP	20371350
MIRT198921	hsa-miR-449a	PAR-CLIP	20371350
MIRT198922	hsa-miR-449b-5p	PAR-CLIP	20371350
MIRT198919	hsa-miR-154-5p	PAR-CLIP	20371350
MIRT198927	hsa-miR-8062	PAR-CLIP	20371350
MIRT565567	hsa-miR-8076	PAR-CLIP	20371350
MIRT054867	hsa-miR-183-5p	PAR-CLIP	20371350
MIRT198909	hsa-miR-4528	PAR-CLIP	20371350
MIRT565566	hsa-miR-548au-3p	PAR-CLIP	20371350
MIRT565565	hsa-miR-616-3p	PAR-CLIP	20371350
MIRT565564	hsa-miR-5701	PAR-CLIP	20371350
MIRT080233	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT080224	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT080225	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT005629	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT005631	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT080226	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT080230	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT080228	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT028004	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT080232	hsa-miR-551b-5p	PAR-CLIP	21572407
MIRT080231	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT080229	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT080227	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT508708	hsa-miR-888-5p	PAR-CLIP	21572407
MIRT007144	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT020189	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT007250	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT080234	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT080240	hsa-miR-3666	PAR-CLIP	21572407
MIRT080239	hsa-miR-4295	PAR-CLIP	21572407
MIRT007251	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT554140	hsa-miR-6715a-3p	PAR-CLIP	21572407
MIRT508707	hsa-miR-371b-5p	PAR-CLIP	21572407
MIRT508706	hsa-miR-373-5p	PAR-CLIP	21572407
MIRT508705	hsa-miR-616-5p	PAR-CLIP	21572407
MIRT508704	hsa-miR-302a-5p	PAR-CLIP	21572407
MIRT080241	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT080235	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT080236	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT080238	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT508703	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT346455	hsa-miR-4668-5p	PAR-CLIP	21572407
MIRT005630	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT031156	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT080245	hsa-miR-6715b-3p	PAR-CLIP	21572407
MIRT080243	hsa-miR-548aw	PAR-CLIP	21572407
MIRT080233	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT080244	hsa-miR-548az-5p	PAR-CLIP	21572407
MIRT080237	hsa-miR-548t-5p	PAR-CLIP	21572407
MIRT080224	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT080225	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT005629	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT005631	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT080226	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT080230	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT080228	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT028004	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT080231	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT080229	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT080227	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT508708	hsa-miR-888-5p	PAR-CLIP	21572407
MIRT007144	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT020189	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT007250	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT080234	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT080240	hsa-miR-3666	PAR-CLIP	21572407
MIRT080239	hsa-miR-4295	PAR-CLIP	21572407
MIRT007251	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT508707	hsa-miR-371b-5p	PAR-CLIP	21572407
MIRT508706	hsa-miR-373-5p	PAR-CLIP	21572407
MIRT508705	hsa-miR-616-5p	PAR-CLIP	21572407
MIRT508704	hsa-miR-302a-5p	PAR-CLIP	21572407
MIRT080241	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT080235	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT080236	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT080238	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT508703	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT005630	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT031156	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT080243	hsa-miR-548aw	PAR-CLIP	21572407
MIRT346455	hsa-miR-4668-5p	PAR-CLIP	21572407
MIRT080233	hsa-miR-548c-3p	PAR-CLIP	23446348
MIRT080224	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT080225	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT005629	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT005631	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT080226	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT080230	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT080228	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT028004	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT080231	hsa-miR-519a-3p	PAR-CLIP	23446348
MIRT080229	hsa-miR-519b-3p	PAR-CLIP	23446348
MIRT080227	hsa-miR-519c-3p	PAR-CLIP	23446348
MIRT508708	hsa-miR-888-5p	PAR-CLIP	23446348
MIRT007144	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT020189	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT007250	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT080234	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT080240	hsa-miR-3666	PAR-CLIP	23446348
MIRT080239	hsa-miR-4295	PAR-CLIP	23446348
MIRT007251	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT508707	hsa-miR-371b-5p	PAR-CLIP	23446348
MIRT508706	hsa-miR-373-5p	PAR-CLIP	23446348
MIRT508705	hsa-miR-616-5p	PAR-CLIP	23446348
MIRT508704	hsa-miR-302a-5p	PAR-CLIP	23446348
MIRT080241	hsa-miR-548aj-5p	PAR-CLIP	23446348
MIRT080235	hsa-miR-548f-5p	PAR-CLIP	23446348
MIRT080236	hsa-miR-548g-5p	PAR-CLIP	23446348
MIRT080238	hsa-miR-548x-5p	PAR-CLIP	23446348
MIRT508703	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT346455	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT005630	hsa-miR-19a-3p	PAR-CLIP	23446348
MIRT031156	hsa-miR-19b-3p	PAR-CLIP	23446348
MIRT080243	hsa-miR-548aw	PAR-CLIP	23446348
MIRT080233	hsa-miR-548c-3p	PAR-CLIP	23446348
MIRT080244	hsa-miR-548az-5p	PAR-CLIP	23446348
MIRT080237	hsa-miR-548t-5p	PAR-CLIP	23446348
MIRT080224	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT080225	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT005629	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT005631	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT080226	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT080230	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT080228	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT028004	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT080231	hsa-miR-519a-3p	PAR-CLIP	23446348
MIRT080229	hsa-miR-519b-3p	PAR-CLIP	23446348
MIRT080227	hsa-miR-519c-3p	PAR-CLIP	23446348
MIRT508708	hsa-miR-888-5p	PAR-CLIP	23446348
MIRT007144	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT020189	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT007250	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT080234	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT080240	hsa-miR-3666	PAR-CLIP	23446348
MIRT080239	hsa-miR-4295	PAR-CLIP	23446348
MIRT007251	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT508707	hsa-miR-371b-5p	PAR-CLIP	23446348
MIRT508706	hsa-miR-373-5p	PAR-CLIP	23446348
MIRT508705	hsa-miR-616-5p	PAR-CLIP	23446348
MIRT508704	hsa-miR-302a-5p	PAR-CLIP	23446348
MIRT080241	hsa-miR-548aj-5p	PAR-CLIP	23446348
MIRT080235	hsa-miR-548f-5p	PAR-CLIP	23446348
MIRT080236	hsa-miR-548g-5p	PAR-CLIP	23446348
MIRT080238	hsa-miR-548x-5p	PAR-CLIP	23446348
MIRT508703	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT346455	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT005630	hsa-miR-19a-3p	PAR-CLIP	23446348
MIRT031156	hsa-miR-19b-3p	PAR-CLIP	23446348
MIRT080243	hsa-miR-548aw	PAR-CLIP	23446348
MIRT007144	hsa-miR-130a-3p	Luciferase reporter assay	26817584
MIRT007250	hsa-miR-301a-3p	sw1990	26019136
MIRT007250	hsa-miR-301a-3p	sw1990	26019136
MIRT731606	hsa-miR-144-3p	Luciferase reporter assay	26918315
MIRT731606	hsa-miR-144-3p	Luciferase reporter assay	26918315
MIRT731606	hsa-miR-144-3p	Luciferase reporter assay	26918315
MIRT006527	hsa-miR-224-5p	Luciferase reporter assayWestern blot	25804630
MIRT006527	hsa-miR-224-5p	Luciferase reporter assayWestern blot	25804630
MIRT006527	hsa-miR-224-5p	Luciferase reporter assayWestern blot	25804630
MIRT004118	hsa-miR-483-3p	Luciferase reporter assayqRT-PCRWestern blot	26747772
MIRT004118	hsa-miR-483-3p	Luciferase reporter assayqRT-PCRWestern blot	26747772
MIRT004118	hsa-miR-483-3p	Luciferase reporter assayqRT-PCRWestern blot	26747772
MIRT004118	hsa-miR-483-3p	Luciferase reporter assayqRT-PCRWestern blot	26747772
MIRT731875	hsa-miR-574-3p	Luciferase reporter assayqRT-PCRWestern blot	28105233
MIRT731875	hsa-miR-574-3p	Luciferase reporter assayqRT-PCRWestern blot	28105233
MIRT731883	mmu-miR-483-3p	qRT-PCRWestern blot	28244607
MIRT731883	mmu-miR-483-3p	qRT-PCRWestern blot	28244607
MIRT732323	hsa-miR-34a-3p	Luciferase reporter assay	28340489
MIRT732323	hsa-miR-34a-3p	Luciferase reporter assay	28340489
MIRT005631	hsa-miR-20a-5p	Luciferase reporter assayqRT-PCRWestern blot	27286257
MIRT005631	hsa-miR-20a-5p	Luciferase reporter assayqRT-PCRWestern blot	27286257
MIRT653372	hsa-miR-27a-3p	ChIP-seqImmunohistochemistry	26600197
MIRT198918	hsa-miR-34a-5p	Luciferase reporter assayWestern blot	28348487
MIRT198918	hsa-miR-34a-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26077733
MIRT006209	hsa-miR-146a-5p	Luciferase reporter assay	27438138
MIRT653372	hsa-miR-27a-3p	Luciferase reporter assayqRT-PCRWestern blot	28370334
MIRT653372	hsa-miR-27a-3p	Luciferase reporter assayqRT-PCRWestern blot	28370334
MIRT732891	hsa-miR-183-3p	Immunoprecipitaion (IP)qRT-PCRWestern blotting	34287793
MIRT732892	hsa-miR-182-3p	Immunoprecipitaion (IP)qRT-PCRWestern blotting	34287793
MIRT732893	hsa-miR-96-3p	Immunoprecipitaion (IP)qRT-PCRWestern blotting	34287793
MIRT733643	hsa-miR-29a-3p	ELISAImmunofluorescenceImmunoprecipitaion (IP)qRT-PCRWestern blotting	34061599
MIRT053029	hsa-miR-204-5p	In situ hybridizationLuciferase reporter assayqRT-PCRWestern blotting	33327804
MIRT734387	hsa-miR-26b-5p	qRT-PCR	34185228
MIRT734495	hsa-miR-552-3p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)ChIP-seqqRT-PCRIn situ hybridization	33867818
MIRT734940	hsa-miR-224-3p	Luciferase reporter assayWestern blottingNorthern blottingImmunoprecipitaion (IP)Immunohistochemistry (IHC)qRT-PCRIn situ hybridization	33172486
MIRT735188	hsa-miR-27a-5p	Luciferase reporter assayWestern blottingqRT-PCR	31710594
MIRT732323	hsa-miR-34a-3p	ImmunofluorescenceqRT-PCR	32929850
MIRT735927	hsa-miR-587	Luciferase reporter assayWestern blottingqRT-PCR	31721529
MIRT053653	hsa-miR-145-5p	Luciferase reporter assayWestern blottingqRT-PCR	32366274
MIRT004118	hsa-miR-483-3p	Luciferase reporter assayWestern blottingMicroarrayin vitro cullelar assaysqRT-PCR	21112326
MIRT198918	hsa-miR-34a-5p	Luciferase reporter assayWestern blottingImmunofluorescenceqRT-PCR	32929850
MIRT653377	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT653376	hsa-miR-6072	HITS-CLIP	23824327
MIRT653375	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT653374	hsa-miR-6731-3p	HITS-CLIP	23824327
MIRT653373	hsa-miR-513a-5p	HITS-CLIP	23824327
MIRT653372	hsa-miR-27a-3p	HITS-CLIP	23824327
MIRT653371	hsa-miR-27b-3p	HITS-CLIP	23824327
MIRT653370	hsa-miR-4799-5p	HITS-CLIP	23824327
MIRT653369	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT080233	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT080244	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT080237	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT080224	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT080225	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT005629	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT005631	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT080226	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT080230	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT080228	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT028004	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT080231	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT080229	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT080227	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT508708	hsa-miR-888-5p	PAR-CLIP	20371350
MIRT007144	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT020189	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT007250	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT080234	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT080240	hsa-miR-3666	PAR-CLIP	20371350
MIRT080239	hsa-miR-4295	PAR-CLIP	20371350
MIRT007251	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT508707	hsa-miR-371b-5p	PAR-CLIP	20371350
MIRT508706	hsa-miR-373-5p	PAR-CLIP	20371350
MIRT508705	hsa-miR-616-5p	PAR-CLIP	20371350
MIRT508704	hsa-miR-302a-5p	PAR-CLIP	20371350
MIRT080241	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT080235	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT080236	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT080238	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT508703	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT005630	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT031156	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT080243	hsa-miR-548aw	PAR-CLIP	20371350
MIRT346455	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT080233	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT080244	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT080237	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT080224	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT080225	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT005629	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT005631	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT080226	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT080230	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT080228	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT028004	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT080231	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT080229	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT080227	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT508708	hsa-miR-888-5p	PAR-CLIP	20371350
MIRT007144	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT020189	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT007250	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT080234	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT080240	hsa-miR-3666	PAR-CLIP	20371350
MIRT080239	hsa-miR-4295	PAR-CLIP	20371350
MIRT007251	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT508707	hsa-miR-371b-5p	PAR-CLIP	20371350
MIRT508706	hsa-miR-373-5p	PAR-CLIP	20371350
MIRT508705	hsa-miR-616-5p	PAR-CLIP	20371350
MIRT508704	hsa-miR-302a-5p	PAR-CLIP	20371350
MIRT080241	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT080235	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT080236	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT080238	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT508703	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT346455	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT005630	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT031156	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT080243	hsa-miR-548aw	PAR-CLIP	20371350
MIRT198920	hsa-miR-34c-5p	PAR-CLIP	20371350
MIRT198918	hsa-miR-34a-5p	PAR-CLIP	20371350
MIRT198921	hsa-miR-449a	PAR-CLIP	20371350
MIRT198922	hsa-miR-449b-5p	PAR-CLIP	20371350
MIRT198919	hsa-miR-154-5p	PAR-CLIP	20371350
MIRT198927	hsa-miR-8062	PAR-CLIP	20371350
MIRT565567	hsa-miR-8076	PAR-CLIP	20371350
MIRT054867	hsa-miR-183-5p	PAR-CLIP	20371350
MIRT198909	hsa-miR-4528	PAR-CLIP	20371350
MIRT565566	hsa-miR-548au-3p	PAR-CLIP	20371350
MIRT565565	hsa-miR-616-3p	PAR-CLIP	20371350
MIRT565564	hsa-miR-5701	PAR-CLIP	20371350
MIRT080233	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT080224	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT080225	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT005629	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT005631	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT080226	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT080230	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT080228	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT028004	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT080232	hsa-miR-551b-5p	PAR-CLIP	21572407
MIRT080231	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT080229	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT080227	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT508708	hsa-miR-888-5p	PAR-CLIP	21572407
MIRT007144	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT020189	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT007250	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT080234	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT080240	hsa-miR-3666	PAR-CLIP	21572407
MIRT080239	hsa-miR-4295	PAR-CLIP	21572407
MIRT007251	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT554140	hsa-miR-6715a-3p	PAR-CLIP	21572407
MIRT508707	hsa-miR-371b-5p	PAR-CLIP	21572407
MIRT508706	hsa-miR-373-5p	PAR-CLIP	21572407
MIRT508705	hsa-miR-616-5p	PAR-CLIP	21572407
MIRT508704	hsa-miR-302a-5p	PAR-CLIP	21572407
MIRT080241	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT080235	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT080236	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT080238	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT508703	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT346455	hsa-miR-4668-5p	PAR-CLIP	21572407
MIRT005630	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT031156	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT080245	hsa-miR-6715b-3p	PAR-CLIP	21572407
MIRT080243	hsa-miR-548aw	PAR-CLIP	21572407
MIRT080233	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT080244	hsa-miR-548az-5p	PAR-CLIP	21572407
MIRT080237	hsa-miR-548t-5p	PAR-CLIP	21572407
MIRT080224	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT080225	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT005629	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT005631	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT080226	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT080230	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT080228	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT028004	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT080231	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT080229	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT080227	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT508708	hsa-miR-888-5p	PAR-CLIP	21572407
MIRT007144	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT020189	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT007250	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT080234	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT080240	hsa-miR-3666	PAR-CLIP	21572407
MIRT080239	hsa-miR-4295	PAR-CLIP	21572407
MIRT007251	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT508707	hsa-miR-371b-5p	PAR-CLIP	21572407
MIRT508706	hsa-miR-373-5p	PAR-CLIP	21572407
MIRT508705	hsa-miR-616-5p	PAR-CLIP	21572407
MIRT508704	hsa-miR-302a-5p	PAR-CLIP	21572407
MIRT080241	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT080235	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT080236	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT080238	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT508703	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT005630	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT031156	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT080243	hsa-miR-548aw	PAR-CLIP	21572407
MIRT346455	hsa-miR-4668-5p	PAR-CLIP	21572407
MIRT080233	hsa-miR-548c-3p	PAR-CLIP	23446348
MIRT080224	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT080225	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT005629	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT005631	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT080226	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT080230	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT080228	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT028004	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT080231	hsa-miR-519a-3p	PAR-CLIP	23446348
MIRT080229	hsa-miR-519b-3p	PAR-CLIP	23446348
MIRT080227	hsa-miR-519c-3p	PAR-CLIP	23446348
MIRT508708	hsa-miR-888-5p	PAR-CLIP	23446348
MIRT007144	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT020189	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT007250	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT080234	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT080240	hsa-miR-3666	PAR-CLIP	23446348
MIRT080239	hsa-miR-4295	PAR-CLIP	23446348
MIRT007251	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT508707	hsa-miR-371b-5p	PAR-CLIP	23446348
MIRT508706	hsa-miR-373-5p	PAR-CLIP	23446348
MIRT508705	hsa-miR-616-5p	PAR-CLIP	23446348
MIRT508704	hsa-miR-302a-5p	PAR-CLIP	23446348
MIRT080241	hsa-miR-548aj-5p	PAR-CLIP	23446348
MIRT080235	hsa-miR-548f-5p	PAR-CLIP	23446348
MIRT080236	hsa-miR-548g-5p	PAR-CLIP	23446348
MIRT080238	hsa-miR-548x-5p	PAR-CLIP	23446348
MIRT508703	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT346455	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT005630	hsa-miR-19a-3p	PAR-CLIP	23446348
MIRT031156	hsa-miR-19b-3p	PAR-CLIP	23446348
MIRT080243	hsa-miR-548aw	PAR-CLIP	23446348
MIRT080233	hsa-miR-548c-3p	PAR-CLIP	23446348
MIRT080244	hsa-miR-548az-5p	PAR-CLIP	23446348
MIRT080237	hsa-miR-548t-5p	PAR-CLIP	23446348
MIRT080224	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT080225	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT005629	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT005631	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT080226	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT080230	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT080228	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT028004	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT080231	hsa-miR-519a-3p	PAR-CLIP	23446348
MIRT080229	hsa-miR-519b-3p	PAR-CLIP	23446348
MIRT080227	hsa-miR-519c-3p	PAR-CLIP	23446348
MIRT508708	hsa-miR-888-5p	PAR-CLIP	23446348
MIRT007144	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT020189	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT007250	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT080234	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT080240	hsa-miR-3666	PAR-CLIP	23446348
MIRT080239	hsa-miR-4295	PAR-CLIP	23446348
MIRT007251	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT508707	hsa-miR-371b-5p	PAR-CLIP	23446348
MIRT508706	hsa-miR-373-5p	PAR-CLIP	23446348
MIRT508705	hsa-miR-616-5p	PAR-CLIP	23446348
MIRT508704	hsa-miR-302a-5p	PAR-CLIP	23446348
MIRT080241	hsa-miR-548aj-5p	PAR-CLIP	23446348
MIRT080235	hsa-miR-548f-5p	PAR-CLIP	23446348
MIRT080236	hsa-miR-548g-5p	PAR-CLIP	23446348
MIRT080238	hsa-miR-548x-5p	PAR-CLIP	23446348
MIRT508703	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT346455	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT005630	hsa-miR-19a-3p	PAR-CLIP	23446348
MIRT031156	hsa-miR-19b-3p	PAR-CLIP	23446348
MIRT080243	hsa-miR-548aw	PAR-CLIP	23446348
MIRT755627	hsa-miR-942-5p	Luciferase reporter assay	36060794
MIRT755879	hsa-miR-6881-3p	Luciferase reporter assayWestern blottingqRT-PCRImmunofluorescenceFlow cytometry	38297261
MIRT755992	ebv-miR-BART6-5p	Luciferase reporter assayWestern blottingqRT-PCR	38686046
MIRT734387	hsa-miR-26b-5p	qRT-PCR	34185228
MIRT756263	hsa-miR-148a-5p	Luciferase reporter assayWestern blottingqRT-PCR	35006577
MIRT756329	hsa-miR-214-5p	Luciferase reporter assayWestern blottingqRT-PCR	34742256
MIRT1370779	hsa-miR-1193	CLIP-seq
MIRT1370780	hsa-miR-1224-3p	CLIP-seq
MIRT1370781	hsa-miR-1253	CLIP-seq
MIRT1370782	hsa-miR-1254	CLIP-seq
MIRT1370783	hsa-miR-1283	CLIP-seq
MIRT1370784	hsa-miR-1285	CLIP-seq
MIRT1370785	hsa-miR-129-5p	CLIP-seq
MIRT1370786	hsa-miR-1827	CLIP-seq
MIRT1370787	hsa-miR-1908	CLIP-seq
MIRT1370788	hsa-miR-1913	CLIP-seq
MIRT1370789	hsa-miR-1976	CLIP-seq
MIRT1370790	hsa-miR-204	CLIP-seq
MIRT1370791	hsa-miR-211	CLIP-seq
MIRT1370792	hsa-miR-2467-3p	CLIP-seq
MIRT1370793	hsa-miR-3116	CLIP-seq
MIRT1370794	hsa-miR-3120-3p	CLIP-seq
MIRT1370795	hsa-miR-3134	CLIP-seq
MIRT1370796	hsa-miR-3148	CLIP-seq
MIRT1370797	hsa-miR-3152-5p	CLIP-seq
MIRT1370798	hsa-miR-3160-3p	CLIP-seq
MIRT1370799	hsa-miR-3161	CLIP-seq
MIRT1370800	hsa-miR-3165	CLIP-seq
MIRT1370801	hsa-miR-3185	CLIP-seq
MIRT1370802	hsa-miR-3187-5p	CLIP-seq
MIRT1370803	hsa-miR-3189-5p	CLIP-seq
MIRT1370804	hsa-miR-324-3p	CLIP-seq
MIRT1370805	hsa-miR-329	CLIP-seq
MIRT1370806	hsa-miR-33a	CLIP-seq
MIRT1370807	hsa-miR-33b	CLIP-seq
MIRT1370808	hsa-miR-340	CLIP-seq
MIRT1370809	hsa-miR-3612	CLIP-seq
MIRT1370810	hsa-miR-3613-3p	CLIP-seq
MIRT1370811	hsa-miR-3614-5p	CLIP-seq
MIRT1370812	hsa-miR-3620	CLIP-seq
MIRT1370813	hsa-miR-3622b-5p	CLIP-seq
MIRT1370814	hsa-miR-362-3p	CLIP-seq
MIRT1370815	hsa-miR-3680	CLIP-seq
MIRT1370816	hsa-miR-3691-5p	CLIP-seq
MIRT1370817	hsa-miR-371-5p	CLIP-seq
MIRT1370818	hsa-miR-3908	CLIP-seq
MIRT1370819	hsa-miR-3925-3p	CLIP-seq
MIRT1370820	hsa-miR-3926	CLIP-seq
MIRT1370821	hsa-miR-3929	CLIP-seq
MIRT1370822	hsa-miR-3938	CLIP-seq
MIRT1370823	hsa-miR-3941	CLIP-seq
MIRT1370824	hsa-miR-3942-3p	CLIP-seq
MIRT1370825	hsa-miR-4257	CLIP-seq
MIRT1370826	hsa-miR-4271	CLIP-seq
MIRT1370827	hsa-miR-4311	CLIP-seq
MIRT1370828	hsa-miR-4330	CLIP-seq
MIRT1370829	hsa-miR-4419b	CLIP-seq
MIRT1370830	hsa-miR-4433	CLIP-seq
MIRT1370831	hsa-miR-4459	CLIP-seq
MIRT1370832	hsa-miR-4462	CLIP-seq
MIRT1370833	hsa-miR-4478	CLIP-seq
MIRT1370834	hsa-miR-4484	CLIP-seq
MIRT1370835	hsa-miR-4487	CLIP-seq
MIRT1370836	hsa-miR-4517	CLIP-seq
MIRT1370837	hsa-miR-4645-5p	CLIP-seq
MIRT1370838	hsa-miR-4649-3p	CLIP-seq
MIRT1370839	hsa-miR-466	CLIP-seq
MIRT1370840	hsa-miR-4662a-5p	CLIP-seq
MIRT1370841	hsa-miR-4672	CLIP-seq
MIRT1370842	hsa-miR-4673	CLIP-seq
MIRT1370843	hsa-miR-4676-5p	CLIP-seq
MIRT1370844	hsa-miR-4681	CLIP-seq
MIRT1370845	hsa-miR-4717-3p	CLIP-seq
MIRT1370846	hsa-miR-4722-3p	CLIP-seq
MIRT1370847	hsa-miR-4722-5p	CLIP-seq
MIRT1370848	hsa-miR-4725-3p	CLIP-seq
MIRT1370849	hsa-miR-4742-5p	CLIP-seq
MIRT1370850	hsa-miR-4755-3p	CLIP-seq
MIRT1370851	hsa-miR-4755-5p	CLIP-seq
MIRT1370852	hsa-miR-4758-3p	CLIP-seq
MIRT1370853	hsa-miR-4761-5p	CLIP-seq
MIRT1370854	hsa-miR-4766-5p	CLIP-seq
MIRT1370855	hsa-miR-4768-3p	CLIP-seq
MIRT1370856	hsa-miR-4768-5p	CLIP-seq
MIRT1370857	hsa-miR-4774-3p	CLIP-seq
MIRT1370858	hsa-miR-4774-5p	CLIP-seq
MIRT1370859	hsa-miR-4779	CLIP-seq
MIRT1370860	hsa-miR-4793-3p	CLIP-seq
MIRT1370861	hsa-miR-4795-5p	CLIP-seq
MIRT1370862	hsa-miR-485-5p	CLIP-seq
MIRT1370863	hsa-miR-488	CLIP-seq
MIRT1370864	hsa-miR-514	CLIP-seq
MIRT1370865	hsa-miR-514b-3p	CLIP-seq
MIRT1370866	hsa-miR-515-5p	CLIP-seq
MIRT1370867	hsa-miR-526b	CLIP-seq
MIRT1370868	hsa-miR-548a-5p	CLIP-seq
MIRT1370869	hsa-miR-548ab	CLIP-seq
MIRT1370870	hsa-miR-548ak	CLIP-seq
MIRT1370871	hsa-miR-548an	CLIP-seq
MIRT1370872	hsa-miR-548b-5p	CLIP-seq
MIRT1370873	hsa-miR-548c-5p	CLIP-seq
MIRT1370874	hsa-miR-548d-5p	CLIP-seq
MIRT1370875	hsa-miR-548h	CLIP-seq
MIRT1370876	hsa-miR-548i	CLIP-seq
MIRT1370877	hsa-miR-548j	CLIP-seq
MIRT1370878	hsa-miR-548n	CLIP-seq
MIRT1370879	hsa-miR-548s	CLIP-seq
MIRT1370880	hsa-miR-548t	CLIP-seq
MIRT1370881	hsa-miR-548w	CLIP-seq
MIRT1370882	hsa-miR-548y	CLIP-seq
MIRT1370883	hsa-miR-558	CLIP-seq
MIRT1370884	hsa-miR-559	CLIP-seq
MIRT1370885	hsa-miR-575	CLIP-seq
MIRT1370886	hsa-miR-578	CLIP-seq
MIRT1370887	hsa-miR-586	CLIP-seq
MIRT1370888	hsa-miR-603	CLIP-seq
MIRT1370889	hsa-miR-612	CLIP-seq
MIRT1370890	hsa-miR-623	CLIP-seq
MIRT1370891	hsa-miR-626	CLIP-seq
MIRT1370892	hsa-miR-627	CLIP-seq
MIRT1370893	hsa-miR-650	CLIP-seq
MIRT1370894	hsa-miR-661	CLIP-seq
MIRT1370895	hsa-miR-663	CLIP-seq
MIRT1370896	hsa-miR-766	CLIP-seq
MIRT1370897	hsa-miR-940	CLIP-seq
MIRT1370898	hsa-miR-942	CLIP-seq
MIRT1553860	hsa-miR-124	CLIP-seq
MIRT1370790	hsa-miR-204	CLIP-seq
MIRT1370791	hsa-miR-211	CLIP-seq
MIRT1370799	hsa-miR-3161	CLIP-seq
MIRT1553861	hsa-miR-3654	CLIP-seq
MIRT1370822	hsa-miR-3938	CLIP-seq
MIRT1553862	hsa-miR-4256	CLIP-seq
MIRT1553863	hsa-miR-4638-3p	CLIP-seq
MIRT1370851	hsa-miR-4755-5p	CLIP-seq
MIRT1370854	hsa-miR-4766-5p	CLIP-seq
MIRT1370863	hsa-miR-488	CLIP-seq
MIRT1553864	hsa-miR-506	CLIP-seq
MIRT1370871	hsa-miR-548an	CLIP-seq
MIRT1370878	hsa-miR-548n	CLIP-seq
MIRT1370890	hsa-miR-623	CLIP-seq
MIRT2110002	hsa-miR-1	CLIP-seq
MIRT2110003	hsa-miR-1243	CLIP-seq
MIRT1370782	hsa-miR-1254	CLIP-seq
MIRT1370784	hsa-miR-1285	CLIP-seq
MIRT2110004	hsa-miR-145	CLIP-seq
MIRT1370789	hsa-miR-1976	CLIP-seq
MIRT1370790	hsa-miR-204	CLIP-seq
MIRT2110005	hsa-miR-206	CLIP-seq
MIRT1370791	hsa-miR-211	CLIP-seq
MIRT2110006	hsa-miR-22	CLIP-seq
MIRT2110007	hsa-miR-221	CLIP-seq
MIRT2110008	hsa-miR-222	CLIP-seq
MIRT1370792	hsa-miR-2467-3p	CLIP-seq
MIRT2110009	hsa-miR-3064-5p	CLIP-seq
MIRT2110010	hsa-miR-3065-5p	CLIP-seq
MIRT1370793	hsa-miR-3116	CLIP-seq
MIRT2110011	hsa-miR-3122	CLIP-seq
MIRT2110012	hsa-miR-3137	CLIP-seq
MIRT1370797	hsa-miR-3152-5p	CLIP-seq
MIRT2110013	hsa-miR-3154	CLIP-seq
MIRT1370799	hsa-miR-3161	CLIP-seq
MIRT2110014	hsa-miR-3177-5p	CLIP-seq
MIRT1370802	hsa-miR-3187-5p	CLIP-seq
MIRT1370810	hsa-miR-3613-3p	CLIP-seq
MIRT1370811	hsa-miR-3614-5p	CLIP-seq
MIRT2110015	hsa-miR-3616-3p	CLIP-seq
MIRT1553861	hsa-miR-3654	CLIP-seq
MIRT2110016	hsa-miR-3673	CLIP-seq
MIRT2110017	hsa-miR-3686	CLIP-seq
MIRT2110018	hsa-miR-3688-5p	CLIP-seq
MIRT2110019	hsa-miR-3689a-3p	CLIP-seq
MIRT2110020	hsa-miR-3689c	CLIP-seq
MIRT1370817	hsa-miR-371-5p	CLIP-seq
MIRT1370818	hsa-miR-3908	CLIP-seq
MIRT2110021	hsa-miR-3913-5p	CLIP-seq
MIRT1370820	hsa-miR-3926	CLIP-seq
MIRT1370822	hsa-miR-3938	CLIP-seq
MIRT2110022	hsa-miR-3942-5p	CLIP-seq
MIRT1370826	hsa-miR-4271	CLIP-seq
MIRT2110023	hsa-miR-4288	CLIP-seq
MIRT1370830	hsa-miR-4433	CLIP-seq
MIRT2110024	hsa-miR-4455	CLIP-seq
MIRT1370831	hsa-miR-4459	CLIP-seq
MIRT2110025	hsa-miR-4474-3p	CLIP-seq
MIRT1553863	hsa-miR-4638-3p	CLIP-seq
MIRT1370840	hsa-miR-4662a-5p	CLIP-seq
MIRT2110026	hsa-miR-4668-3p	CLIP-seq
MIRT2110027	hsa-miR-4703-5p	CLIP-seq
MIRT1370846	hsa-miR-4722-3p	CLIP-seq
MIRT1370848	hsa-miR-4725-3p	CLIP-seq
MIRT2110028	hsa-miR-4728-5p	CLIP-seq
MIRT1370851	hsa-miR-4755-5p	CLIP-seq
MIRT1370853	hsa-miR-4761-5p	CLIP-seq
MIRT2110029	hsa-miR-4766-3p	CLIP-seq
MIRT1370854	hsa-miR-4766-5p	CLIP-seq
MIRT1370855	hsa-miR-4768-3p	CLIP-seq
MIRT1370857	hsa-miR-4774-3p	CLIP-seq
MIRT1370858	hsa-miR-4774-5p	CLIP-seq
MIRT2110030	hsa-miR-4777-3p	CLIP-seq
MIRT2110031	hsa-miR-4778-5p	CLIP-seq
MIRT1370859	hsa-miR-4779	CLIP-seq
MIRT2110032	hsa-miR-4786-5p	CLIP-seq
MIRT1370860	hsa-miR-4793-3p	CLIP-seq
MIRT1370861	hsa-miR-4795-5p	CLIP-seq
MIRT2110033	hsa-miR-4802-3p	CLIP-seq
MIRT1370863	hsa-miR-488	CLIP-seq
MIRT2110034	hsa-miR-545	CLIP-seq
MIRT1370879	hsa-miR-548s	CLIP-seq
MIRT2110035	hsa-miR-570	CLIP-seq
MIRT2110036	hsa-miR-605	CLIP-seq
MIRT2110037	hsa-miR-609	CLIP-seq
MIRT1370889	hsa-miR-612	CLIP-seq
MIRT2110038	hsa-miR-613	CLIP-seq
MIRT1370890	hsa-miR-623	CLIP-seq
MIRT2110039	hsa-miR-632	CLIP-seq
MIRT1370894	hsa-miR-661	CLIP-seq
MIRT2110040	hsa-miR-664	CLIP-seq
MIRT2110041	hsa-miR-665	CLIP-seq
MIRT2110002	hsa-miR-1	CLIP-seq
MIRT2333494	hsa-miR-103a	CLIP-seq
MIRT2333495	hsa-miR-107	CLIP-seq
MIRT1370779	hsa-miR-1193	CLIP-seq
MIRT2333496	hsa-miR-1206	CLIP-seq
MIRT2333497	hsa-miR-1207-3p	CLIP-seq
MIRT2333498	hsa-miR-1237	CLIP-seq
MIRT2110003	hsa-miR-1243	CLIP-seq
MIRT1370782	hsa-miR-1254	CLIP-seq
MIRT2333499	hsa-miR-1255a	CLIP-seq
MIRT2333500	hsa-miR-1255b	CLIP-seq
MIRT2333501	hsa-miR-1264	CLIP-seq
MIRT2333502	hsa-miR-1265	CLIP-seq
MIRT2333503	hsa-miR-128	CLIP-seq
MIRT1370783	hsa-miR-1283	CLIP-seq
MIRT2333504	hsa-miR-1284	CLIP-seq
MIRT1370784	hsa-miR-1285	CLIP-seq
MIRT2333505	hsa-miR-1298	CLIP-seq
MIRT2333506	hsa-miR-1299	CLIP-seq
MIRT2333507	hsa-miR-1305	CLIP-seq
MIRT2333508	hsa-miR-130a	CLIP-seq
MIRT2333509	hsa-miR-130b	CLIP-seq
MIRT2333510	hsa-miR-1343	CLIP-seq
MIRT2333511	hsa-miR-140-5p	CLIP-seq
MIRT2333512	hsa-miR-141	CLIP-seq
MIRT2333513	hsa-miR-144	CLIP-seq
MIRT2110004	hsa-miR-145	CLIP-seq
MIRT1370786	hsa-miR-1827	CLIP-seq
MIRT2333514	hsa-miR-183	CLIP-seq
MIRT2333515	hsa-miR-188-5p	CLIP-seq
MIRT1370787	hsa-miR-1908	CLIP-seq
MIRT1370789	hsa-miR-1976	CLIP-seq
MIRT2333516	hsa-miR-200a	CLIP-seq
MIRT2333517	hsa-miR-200b	CLIP-seq
MIRT2333518	hsa-miR-200c	CLIP-seq
MIRT2333519	hsa-miR-203	CLIP-seq
MIRT1370790	hsa-miR-204	CLIP-seq
MIRT2110005	hsa-miR-206	CLIP-seq
MIRT1370791	hsa-miR-211	CLIP-seq
MIRT2110006	hsa-miR-22	CLIP-seq
MIRT2333520	hsa-miR-224	CLIP-seq
MIRT2333521	hsa-miR-2392	CLIP-seq
MIRT1370792	hsa-miR-2467-3p	CLIP-seq
MIRT2333522	hsa-miR-27a	CLIP-seq
MIRT2333523	hsa-miR-27b	CLIP-seq
MIRT2333524	hsa-miR-28-5p	CLIP-seq
MIRT2333525	hsa-miR-296-5p	CLIP-seq
MIRT2333526	hsa-miR-298	CLIP-seq
MIRT2333527	hsa-miR-300	CLIP-seq
MIRT2333528	hsa-miR-301a	CLIP-seq
MIRT2333529	hsa-miR-301b	CLIP-seq
MIRT2110009	hsa-miR-3064-5p	CLIP-seq
MIRT1370793	hsa-miR-3116	CLIP-seq
MIRT2333530	hsa-miR-3120-5p	CLIP-seq
MIRT2333531	hsa-miR-3121-5p	CLIP-seq
MIRT2110011	hsa-miR-3122	CLIP-seq
MIRT2333532	hsa-miR-3130-3p	CLIP-seq
MIRT1370795	hsa-miR-3134	CLIP-seq
MIRT2110012	hsa-miR-3137	CLIP-seq
MIRT2333533	hsa-miR-3139	CLIP-seq
MIRT1370796	hsa-miR-3148	CLIP-seq
MIRT2333534	hsa-miR-3156-5p	CLIP-seq
MIRT1370798	hsa-miR-3160-3p	CLIP-seq
MIRT1370799	hsa-miR-3161	CLIP-seq
MIRT1370800	hsa-miR-3165	CLIP-seq
MIRT2333535	hsa-miR-3173-3p	CLIP-seq
MIRT2333536	hsa-miR-3180-5p	CLIP-seq
MIRT1370802	hsa-miR-3187-5p	CLIP-seq
MIRT2333537	hsa-miR-3190	CLIP-seq
MIRT2333538	hsa-miR-3199	CLIP-seq
MIRT2333539	hsa-miR-320a	CLIP-seq
MIRT2333540	hsa-miR-320b	CLIP-seq
MIRT2333541	hsa-miR-320c	CLIP-seq
MIRT2333542	hsa-miR-320d	CLIP-seq
MIRT2333543	hsa-miR-323-3p	CLIP-seq
MIRT2333544	hsa-miR-346	CLIP-seq
MIRT2333545	hsa-miR-34c-3p	CLIP-seq
MIRT1370809	hsa-miR-3612	CLIP-seq
MIRT1370810	hsa-miR-3613-3p	CLIP-seq
MIRT1370811	hsa-miR-3614-5p	CLIP-seq
MIRT1370813	hsa-miR-3622b-5p	CLIP-seq
MIRT2333546	hsa-miR-3647-3p	CLIP-seq
MIRT1553861	hsa-miR-3654	CLIP-seq
MIRT2333547	hsa-miR-3662	CLIP-seq
MIRT2333548	hsa-miR-3667-3p	CLIP-seq
MIRT2110016	hsa-miR-3673	CLIP-seq
MIRT2333549	hsa-miR-3674	CLIP-seq
MIRT2110017	hsa-miR-3686	CLIP-seq
MIRT2110019	hsa-miR-3689a-3p	CLIP-seq
MIRT2110020	hsa-miR-3689c	CLIP-seq
MIRT1370816	hsa-miR-3691-5p	CLIP-seq
MIRT2333550	hsa-miR-3714	CLIP-seq
MIRT1370817	hsa-miR-371-5p	CLIP-seq
MIRT2333551	hsa-miR-377	CLIP-seq
MIRT2333552	hsa-miR-381	CLIP-seq
MIRT1370818	hsa-miR-3908	CLIP-seq
MIRT2110021	hsa-miR-3913-5p	CLIP-seq
MIRT1370820	hsa-miR-3926	CLIP-seq
MIRT1370822	hsa-miR-3938	CLIP-seq
MIRT1370824	hsa-miR-3942-3p	CLIP-seq
MIRT2110022	hsa-miR-3942-5p	CLIP-seq
MIRT2333553	hsa-miR-3974	CLIP-seq
MIRT2333554	hsa-miR-411	CLIP-seq
MIRT1370825	hsa-miR-4257	CLIP-seq
MIRT2333555	hsa-miR-4282	CLIP-seq
MIRT2110023	hsa-miR-4288	CLIP-seq
MIRT2333556	hsa-miR-429	CLIP-seq
MIRT2333557	hsa-miR-4428	CLIP-seq
MIRT2333558	hsa-miR-4429	CLIP-seq
MIRT1370830	hsa-miR-4433	CLIP-seq
MIRT2333559	hsa-miR-4451	CLIP-seq
MIRT2333560	hsa-miR-4453	CLIP-seq
MIRT2110024	hsa-miR-4455	CLIP-seq
MIRT1370831	hsa-miR-4459	CLIP-seq
MIRT2333561	hsa-miR-4470	CLIP-seq
MIRT2333562	hsa-miR-4474-5p	CLIP-seq
MIRT2333563	hsa-miR-4477b	CLIP-seq
MIRT1370835	hsa-miR-4487	CLIP-seq
MIRT2333564	hsa-miR-4491	CLIP-seq
MIRT2333565	hsa-miR-450b-5p	CLIP-seq
MIRT1370836	hsa-miR-4517	CLIP-seq
MIRT2333566	hsa-miR-4536	CLIP-seq
MIRT2333567	hsa-miR-4538	CLIP-seq
MIRT2333568	hsa-miR-454	CLIP-seq
MIRT1370837	hsa-miR-4645-5p	CLIP-seq
MIRT2333569	hsa-miR-4652-3p	CLIP-seq
MIRT2333570	hsa-miR-4657	CLIP-seq
MIRT1370840	hsa-miR-4662a-5p	CLIP-seq
MIRT2333571	hsa-miR-4666-3p	CLIP-seq
MIRT2110026	hsa-miR-4668-3p	CLIP-seq
MIRT1370842	hsa-miR-4673	CLIP-seq
MIRT1370843	hsa-miR-4676-5p	CLIP-seq
MIRT2333572	hsa-miR-4684-5p	CLIP-seq
MIRT2110027	hsa-miR-4703-5p	CLIP-seq
MIRT2333573	hsa-miR-4708-3p	CLIP-seq
MIRT2333574	hsa-miR-4716-5p	CLIP-seq
MIRT1370845	hsa-miR-4717-3p	CLIP-seq
MIRT1370846	hsa-miR-4722-3p	CLIP-seq
MIRT2110028	hsa-miR-4728-5p	CLIP-seq
MIRT2333575	hsa-miR-4729	CLIP-seq
MIRT1370849	hsa-miR-4742-5p	CLIP-seq
MIRT2333576	hsa-miR-4753-5p	CLIP-seq
MIRT1370850	hsa-miR-4755-3p	CLIP-seq
MIRT1370851	hsa-miR-4755-5p	CLIP-seq
MIRT1370853	hsa-miR-4761-5p	CLIP-seq
MIRT2333577	hsa-miR-4762-5p	CLIP-seq
MIRT2110029	hsa-miR-4766-3p	CLIP-seq
MIRT1370854	hsa-miR-4766-5p	CLIP-seq
MIRT1370855	hsa-miR-4768-3p	CLIP-seq
MIRT2333578	hsa-miR-4776-3p	CLIP-seq
MIRT2110030	hsa-miR-4777-3p	CLIP-seq
MIRT2110031	hsa-miR-4778-5p	CLIP-seq
MIRT2333579	hsa-miR-4782-5p	CLIP-seq
MIRT1370860	hsa-miR-4793-3p	CLIP-seq
MIRT2333580	hsa-miR-4793-5p	CLIP-seq
MIRT2110033	hsa-miR-4802-3p	CLIP-seq
MIRT2333581	hsa-miR-485-3p	CLIP-seq
MIRT2333582	hsa-miR-487a	CLIP-seq
MIRT1370863	hsa-miR-488	CLIP-seq
MIRT2333583	hsa-miR-500a	CLIP-seq
MIRT2333584	hsa-miR-508-3p	CLIP-seq
MIRT2333585	hsa-miR-513a-3p	CLIP-seq
MIRT2333586	hsa-miR-516b	CLIP-seq
MIRT2333587	hsa-miR-520a-5p	CLIP-seq
MIRT2333588	hsa-miR-520d-5p	CLIP-seq
MIRT2333589	hsa-miR-524-5p	CLIP-seq
MIRT2333590	hsa-miR-525-5p	CLIP-seq
MIRT2333591	hsa-miR-544	CLIP-seq
MIRT2110034	hsa-miR-545	CLIP-seq
MIRT2333592	hsa-miR-548l	CLIP-seq
MIRT1370878	hsa-miR-548n	CLIP-seq
MIRT1370879	hsa-miR-548s	CLIP-seq
MIRT1370880	hsa-miR-548t	CLIP-seq
MIRT1370883	hsa-miR-558	CLIP-seq
MIRT2333593	hsa-miR-561	CLIP-seq
MIRT1370885	hsa-miR-575	CLIP-seq
MIRT2333594	hsa-miR-577	CLIP-seq
MIRT1370889	hsa-miR-612	CLIP-seq
MIRT2110038	hsa-miR-613	CLIP-seq
MIRT1370890	hsa-miR-623	CLIP-seq
MIRT2110039	hsa-miR-632	CLIP-seq
MIRT2333595	hsa-miR-633	CLIP-seq
MIRT2333596	hsa-miR-646	CLIP-seq
MIRT1370893	hsa-miR-650	CLIP-seq
MIRT1370894	hsa-miR-661	CLIP-seq
MIRT1370895	hsa-miR-663	CLIP-seq
MIRT2333597	hsa-miR-708	CLIP-seq
MIRT2333598	hsa-miR-885-5p	CLIP-seq
MIRT2333599	hsa-miR-889	CLIP-seq
MIRT2333600	hsa-miR-891b	CLIP-seq
MIRT2333601	hsa-miR-922	CLIP-seq
MIRT1370805	hsa-miR-329	CLIP-seq
MIRT1370814	hsa-miR-362-3p	CLIP-seq
MIRT1370831	hsa-miR-4459	CLIP-seq
MIRT1370860	hsa-miR-4793-3p	CLIP-seq
MIRT1370783	hsa-miR-1283	CLIP-seq
MIRT1370837	hsa-miR-4645-5p	CLIP-seq
MIRT1370840	hsa-miR-4662a-5p	CLIP-seq
MIRT1370842	hsa-miR-4673	CLIP-seq
MIRT1370843	hsa-miR-4676-5p	CLIP-seq
MIRT2333572	hsa-miR-4684-5p	CLIP-seq
MIRT1370850	hsa-miR-4755-3p	CLIP-seq
MIRT2459985	hsa-miR-548a-3p	CLIP-seq
MIRT2459986	hsa-miR-548e	CLIP-seq
MIRT2459987	hsa-miR-548f	CLIP-seq
MIRT1370885	hsa-miR-575	CLIP-seq
MIRT2627790	hsa-miR-1252	CLIP-seq
MIRT1370783	hsa-miR-1283	CLIP-seq
MIRT2627791	hsa-miR-134	CLIP-seq
MIRT2110004	hsa-miR-145	CLIP-seq
MIRT2627792	hsa-miR-190	CLIP-seq
MIRT2627793	hsa-miR-190b	CLIP-seq
MIRT2333524	hsa-miR-28-5p	CLIP-seq
MIRT2627794	hsa-miR-3118	CLIP-seq
MIRT2333530	hsa-miR-3120-5p	CLIP-seq
MIRT2110011	hsa-miR-3122	CLIP-seq
MIRT2627795	hsa-miR-3125	CLIP-seq
MIRT2627796	hsa-miR-3129-3p	CLIP-seq
MIRT2333533	hsa-miR-3139	CLIP-seq
MIRT2627797	hsa-miR-3140-3p	CLIP-seq
MIRT1370796	hsa-miR-3148	CLIP-seq
MIRT2627798	hsa-miR-3158-3p	CLIP-seq
MIRT2627799	hsa-miR-3163	CLIP-seq
MIRT2627800	hsa-miR-3164	CLIP-seq
MIRT1370803	hsa-miR-3189-5p	CLIP-seq
MIRT2627801	hsa-miR-338-5p	CLIP-seq
MIRT2333544	hsa-miR-346	CLIP-seq
MIRT2627802	hsa-miR-3591-5p	CLIP-seq
MIRT2333547	hsa-miR-3662	CLIP-seq
MIRT2110019	hsa-miR-3689a-3p	CLIP-seq
MIRT2110020	hsa-miR-3689c	CLIP-seq
MIRT2333550	hsa-miR-3714	CLIP-seq
MIRT1370818	hsa-miR-3908	CLIP-seq
MIRT2110021	hsa-miR-3913-5p	CLIP-seq
MIRT2627803	hsa-miR-3916	CLIP-seq
MIRT2110022	hsa-miR-3942-5p	CLIP-seq
MIRT2627804	hsa-miR-410	CLIP-seq
MIRT2627805	hsa-miR-412	CLIP-seq
MIRT2627806	hsa-miR-4255	CLIP-seq
MIRT2110023	hsa-miR-4288	CLIP-seq
MIRT2627807	hsa-miR-431	CLIP-seq
MIRT2627808	hsa-miR-4446-5p	CLIP-seq
MIRT2333561	hsa-miR-4470	CLIP-seq
MIRT2627809	hsa-miR-4501	CLIP-seq
MIRT2627810	hsa-miR-4522	CLIP-seq
MIRT2333569	hsa-miR-4652-3p	CLIP-seq
MIRT1370840	hsa-miR-4662a-5p	CLIP-seq
MIRT1370843	hsa-miR-4676-5p	CLIP-seq
MIRT2627811	hsa-miR-4680-3p	CLIP-seq
MIRT2333572	hsa-miR-4684-5p	CLIP-seq
MIRT2110027	hsa-miR-4703-5p	CLIP-seq
MIRT2333573	hsa-miR-4708-3p	CLIP-seq
MIRT2627812	hsa-miR-4709-3p	CLIP-seq
MIRT2110028	hsa-miR-4728-5p	CLIP-seq
MIRT1370851	hsa-miR-4755-5p	CLIP-seq
MIRT1370852	hsa-miR-4758-3p	CLIP-seq
MIRT1370853	hsa-miR-4761-5p	CLIP-seq
MIRT2110029	hsa-miR-4766-3p	CLIP-seq
MIRT2627813	hsa-miR-518a-5p	CLIP-seq
MIRT2627814	hsa-miR-522	CLIP-seq
MIRT2627815	hsa-miR-527	CLIP-seq
MIRT2110034	hsa-miR-545	CLIP-seq
MIRT2459985	hsa-miR-548a-3p	CLIP-seq
MIRT2627816	hsa-miR-548ae	CLIP-seq
MIRT2627817	hsa-miR-548aj	CLIP-seq
MIRT2627818	hsa-miR-548am	CLIP-seq
MIRT2459986	hsa-miR-548e	CLIP-seq
MIRT2459987	hsa-miR-548f	CLIP-seq
MIRT2627819	hsa-miR-548x	CLIP-seq
MIRT2333593	hsa-miR-561	CLIP-seq
MIRT1370885	hsa-miR-575	CLIP-seq
MIRT2627820	hsa-miR-590-3p	CLIP-seq
MIRT2110039	hsa-miR-632	CLIP-seq
MIRT2333597	hsa-miR-708	CLIP-seq
MIRT2627790	hsa-miR-1252	CLIP-seq
MIRT2333512	hsa-miR-141	CLIP-seq
MIRT2627792	hsa-miR-190	CLIP-seq
MIRT2627793	hsa-miR-190b	CLIP-seq
MIRT2333516	hsa-miR-200a	CLIP-seq
MIRT2110011	hsa-miR-3122	CLIP-seq
MIRT2627797	hsa-miR-3140-3p	CLIP-seq
MIRT2627798	hsa-miR-3158-3p	CLIP-seq
MIRT1370800	hsa-miR-3165	CLIP-seq
MIRT2627802	hsa-miR-3591-5p	CLIP-seq
MIRT2110019	hsa-miR-3689a-3p	CLIP-seq
MIRT2110020	hsa-miR-3689c	CLIP-seq
MIRT1370818	hsa-miR-3908	CLIP-seq
MIRT2110021	hsa-miR-3913-5p	CLIP-seq
MIRT2110022	hsa-miR-3942-5p	CLIP-seq
MIRT2627804	hsa-miR-410	CLIP-seq
MIRT2627805	hsa-miR-412	CLIP-seq
MIRT2627806	hsa-miR-4255	CLIP-seq
MIRT2627808	hsa-miR-4446-5p	CLIP-seq
MIRT1370831	hsa-miR-4459	CLIP-seq
MIRT2333561	hsa-miR-4470	CLIP-seq
MIRT2110027	hsa-miR-4703-5p	CLIP-seq
MIRT2110028	hsa-miR-4728-5p	CLIP-seq
MIRT1370851	hsa-miR-4755-5p	CLIP-seq
MIRT1370853	hsa-miR-4761-5p	CLIP-seq
MIRT2110029	hsa-miR-4766-3p	CLIP-seq

Show/Hide all (5)

Transcription factor	Regulation	Reference
FOS	Unknown	11854297
GLI1	Unknown	24739390
HDAC4	Unknown	23817620
JUNB	Unknown	11854297
KAT2B	Activation	19525977

193

Show/Hide all (193)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000785	Component	Chromatin	IDA	21828274
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	17438144
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	9389648, 18832382, 31582430
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001222	Function	Transcription corepressor binding	IPI	14612439
GO:0001223	Function	Transcription coactivator binding	IPI	16777850
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	9389648, 18832382
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001541	Process	Ovarian follicle development	IEA
GO:0001541	Process	Ovarian follicle development	IEA
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IEA
GO:0001666	Process	Response to hypoxia	IMP	12411310
GO:0001701	Process	In utero embryonic development	IEA
GO:0001702	Process	Gastrulation with mouth forming second	IEA
GO:0001822	Process	Kidney development	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	IGI	23221074
GO:0001837	Process	Epithelial to mesenchymal transition	IMP	30741461
GO:0003148	Process	Outflow tract septum morphogenesis	IEA
GO:0003148	Process	Outflow tract septum morphogenesis	ISS
GO:0003161	Process	Cardiac conduction system development	NAS	26786210
GO:0003190	Process	Atrioventricular valve formation	IEA
GO:0003190	Process	Atrioventricular valve formation	ISS
GO:0003198	Process	Epithelial to mesenchymal transition involved in endocardial cushion formation	IEA
GO:0003220	Process	Left ventricular cardiac muscle tissue morphogenesis	IEA
GO:0003220	Process	Left ventricular cardiac muscle tissue morphogenesis	ISS
GO:0003251	Process	Positive regulation of cell proliferation involved in heart valve morphogenesis	IEA
GO:0003251	Process	Positive regulation of cell proliferation involved in heart valve morphogenesis	ISS
GO:0003279	Process	Cardiac septum development	IEA
GO:0003360	Process	Brainstem development	IEA
GO:0003677	Function	DNA binding	IDA	9389648
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	17438144
GO:0003700	Function	DNA-binding transcription factor activity	IDA	10823886
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	9389648, 9436979, 9707553, 11278302, 11779503, 11779505, 12419246, 14525983, 14671321, 15084259, 15231748, 15350224, 15881652, 16189514, 16865698, 17099224, 17183365, 17469184, 18511908, 18568018, 18729074, 18832382, 19032343, 19135894, 20211142, 20603019, 21297662, 21532621, 215974
GO:0005518	Function	Collagen binding	IEA
GO:0005634	Component	Nucleus	IDA	9311995, 9389648, 12161428, 16007207
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IDA	17438144
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005667	Component	Transcription regulator complex	IPI	12374795
GO:0005737	Component	Cytoplasm	IDA	9311995, 9389648, 12161428
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006351	Process	DNA-templated transcription	IDA	11779505
GO:0006351	Process	DNA-templated transcription	NAS	15350224
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	35359452
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006879	Process	Intracellular iron ion homeostasis	IEA
GO:0006879	Process	Intracellular iron ion homeostasis	ISS
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IBA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	9311995, 9389648, 9732876, 10823886
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IGI	22821565
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IMP	8774881, 23221074, 25514493
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	ISS
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	NAS	35359452
GO:0007283	Process	Spermatogenesis	IEA
GO:0007338	Process	Single fertilization	IEA
GO:0007369	Process	Gastrulation	IEA
GO:0007411	Process	Axon guidance	IEA
GO:0007492	Process	Endoderm development	IEA
GO:0007498	Process	Mesoderm development	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008584	Process	Male gonad development	IEA
GO:0008585	Process	Female gonad development	IEA
GO:0009653	Process	Anatomical structure morphogenesis	IBA
GO:0009653	Process	Anatomical structure morphogenesis	IEA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010614	Process	Negative regulation of cardiac muscle hypertrophy	IEA
GO:0010614	Process	Negative regulation of cardiac muscle hypertrophy	ISS
GO:0010628	Process	Positive regulation of gene expression	IMP	26747772
GO:0010631	Process	Epithelial cell migration	IMP	30741461
GO:0010666	Process	Positive regulation of cardiac muscle cell apoptotic process	IEA
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IEA
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	ISS
GO:0014033	Process	Neural crest cell differentiation	IEA
GO:0014898	Process	Cardiac muscle hypertrophy in response to stress	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0030308	Process	Negative regulation of cell growth	IDA	8774881
GO:0030325	Process	Adrenal gland development	IEA
GO:0030509	Process	BMP signaling pathway	IBA
GO:0030509	Process	BMP signaling pathway	IDA	8653785
GO:0030509	Process	BMP signaling pathway	IDA	8637600, 9389648
GO:0030509	Process	BMP signaling pathway	IEA
GO:0030509	Process	BMP signaling pathway	IGI	22821565
GO:0030509	Process	BMP signaling pathway	IMP	19366699
GO:0030509	Process	BMP signaling pathway	ISS
GO:0030511	Process	Positive regulation of transforming growth factor beta receptor signaling pathway	IDA	19328798
GO:0031005	Function	Filamin binding	IEA
GO:0032444	Component	Activin responsive factor complex	IDA	9389648
GO:0032525	Process	Somite rostral/caudal axis specification	IEA
GO:0032909	Process	Regulation of transforming growth factor beta2 production	IMP	12411310
GO:0032924	Process	Activin receptor signaling pathway	NAS	15150278, 15350224
GO:0032991	Component	Protein-containing complex	IEA
GO:0033686	Process	Positive regulation of luteinizing hormone secretion	IEA
GO:0035556	Process	Intracellular signal transduction	IMP	22316667
GO:0036064	Component	Ciliary basal body	IDA
GO:0036302	Process	Atrioventricular canal development	IEA
GO:0036302	Process	Atrioventricular canal development	ISS
GO:0042118	Process	Endothelial cell activation	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042177	Process	Negative regulation of protein catabolic process	IEA
GO:0042733	Process	Embryonic digit morphogenesis	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	9111321, 10647180, 21988832, 25609649, 35512704
GO:0042803	Function	Protein homodimerization activity	IPI	8774881
GO:0043199	Function	Sulfate binding	IMP	10647180
GO:0043565	Function	Sequence-specific DNA binding	IDA	10823886
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	8774881
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	8774881, 9311995, 9389648, 9707553, 9732876
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9389648, 18832382
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	TAS	14687659
GO:0046332	Function	SMAD binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046881	Process	Positive regulation of follicle-stimulating hormone secretion	IEA
GO:0048382	Process	Mesendoderm development	IEA
GO:0048589	Process	Developmental growth	IEA
GO:0048663	Process	Neuron fate commitment	IEA
GO:0048665	Process	Neuron fate specification	IMP	22357933
GO:0048729	Process	Tissue morphogenesis	IEA
GO:0048733	Process	Sebaceous gland development	IEA
GO:0048859	Process	Formation of anatomical boundary	IEA
GO:0051797	Process	Regulation of hair follicle development	IEA
GO:0060065	Process	Uterus development	IEA
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IEA
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	ISS
GO:0060395	Process	SMAD protein signal transduction	IBA
GO:0060395	Process	SMAD protein signal transduction	IDA	9311995, 9707553, 9732876, 10823886, 22821565
GO:0060395	Process	SMAD protein signal transduction	IEA
GO:0060395	Process	SMAD protein signal transduction	IMP	23221074, 26747772
GO:0060395	Process	SMAD protein signal transduction	ISS
GO:0060412	Process	Ventricular septum morphogenesis	IEA
GO:0060412	Process	Ventricular septum morphogenesis	ISS
GO:0060956	Process	Endocardial cell differentiation	IEA
GO:0060956	Process	Endocardial cell differentiation	ISS
GO:0061040	Process	Female gonad morphogenesis	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0062009	Process	Secondary palate development	IEA
GO:0062009	Process	Secondary palate development	ISS
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IEA
GO:0070102	Process	Interleukin-6-mediated signaling pathway	ISS
GO:0070371	Process	ERK1 and ERK2 cascade	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	ISS
GO:0070411	Function	I-SMAD binding	IBA
GO:0070411	Function	I-SMAD binding	IPI	9256479
GO:0070412	Function	R-SMAD binding	IPI	8774881, 9111321, 9311995, 9732876
GO:0071141	Component	SMAD protein complex	IDA	18832382
GO:0071141	Component	SMAD protein complex	IMP	10647180
GO:0071144	Component	Heteromeric SMAD protein complex	IBA
GO:0071144	Component	Heteromeric SMAD protein complex	IPI	11779505, 15350224
GO:0071144	Component	Heteromeric SMAD protein complex	NAS	16322555
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0071559	Process	Response to transforming growth factor beta	IDA	9707553
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IMP	23221074
GO:0071773	Process	Cellular response to BMP stimulus	NAS	14687659
GO:0072133	Process	Metanephric mesenchyme morphogenesis	IEA
GO:0072134	Process	Nephrogenic mesenchyme morphogenesis	IEA
GO:0072520	Process	Seminiferous tubule development	IEA
GO:0080090	Process	Regulation of primary metabolic process	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IMP	23538390
GO:0090575	Component	RNA polymerase II transcription regulator complex	IEA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IMP	22821565
GO:0141091	Process	Transforming growth factor beta receptor superfamily signaling pathway	IEA
GO:1901203	Process	Positive regulation of extracellular matrix assembly	IMP	26747772
GO:1902895	Process	Positive regulation of miRNA transcription	IEA
GO:1905305	Process	Negative regulation of cardiac myofibril assembly	IEA
GO:1905305	Process	Negative regulation of cardiac myofibril assembly	ISS

MIM	HGNC	e!Ensembl
600993	6770	ENSG00000141646

Q13485

Protein name

Mothers against decapentaplegic homolog 4 (MAD homolog 4) (Mothers against DPP homolog 4) (Deletion target in pancreatic carcinoma 4) (SMAD family member 4) (SMAD 4) (Smad4) (hSMAD4)

Protein function

In muscle physiology, plays a central role in the balance between atrophy and hypertrophy. When recruited by MSTN, promotes atrophy response via phosphorylated SMAD2/4. MSTN decrease causes SMAD4 release and subsequent recruitment by the BMP pat

PDB

1DD1 , 1G88 , 1MR1 , 1U7F , 1U7V , 1YGS , 5C4V , 5MEY , 5MEZ , 5MF0 , 5UWU , 6YIC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03165	MH1	36 → 137	MH1 domain	Domain
PF03166	MH2	321 → 530	MH2 domain	Family

Sequence

MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD
RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP
AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL
HTMPIADPQPLD

Sequence length

552

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (22)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Abnormal bleeding	Pathogenic	rs771084683	RCV001270577	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Carcinoma of colon	Pathogenic	rs2144427253, rs80338965	RCV001358302 RCV001357425	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Carcinoma of pancreas	Pathogenic; Likely pathogenic	rs80338965, rs121912576, rs121912578, rs121912579, rs377767347, rs121912577, rs281875322, rs397518413	RCV000768095 RCV000009062 RCV000009064 RCV000009065 RCV000763030 RCV000009063 RCV000763031 RCV002483120 View all (3 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Colorectal cancer	Pathogenic; Likely pathogenic	rs2144446385, rs80338964, rs377767347, rs1599195400, rs1910183166	RCV006250185 RCV006250161 RCV006253678 RCV006250180 RCV001293846	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Familial aortopathy	Pathogenic	rs281875322	RCV005417436	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Familial renal glucosuria	Pathogenic	rs281875322	RCV005862733	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Familial thoracic aortic aneurysm and aortic dissection	Pathogenic; Likely pathogenic	rs2144419362, rs587780124, rs2144451929, rs587781359, rs80338965, rs587783060, rs2511369450, rs2511369505, rs2511369618, rs377767386, rs2511384558, rs2511374731, rs2511374326, rs2511374597, rs2511382851 View all (89 more)	RCV004995731 RCV002381421 RCV004558764 RCV002310714 RCV002311019 View all (105 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Gallbladder cancer	Pathogenic	rs377767360	RCV001374448	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Gastric cancer	Pathogenic	rs2144419744, rs2511384705	RCV003164589 RCV003164697	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Generalized juvenile polyposis/juvenile polyposis coli	Pathogenic; Likely pathogenic	rs80338965, rs587783060, rs786204125, rs864622252, rs80338963, rs80338964, rs377767347, rs281875322, rs1555686616, rs1555686624, rs1555687572, rs377767355, rs1909895611, rs1909795990, rs397518413, rs1910480814 View all (1 more)	RCV000205495 RCV000144660 RCV000168084 RCV000205617 RCV000009071 View all (11 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Hereditary cancer-predisposing syndrome	Pathogenic; Likely pathogenic	rs2144419362, rs587780124, rs2144451929, rs587781359, rs587781618, rs80338965, rs587783060, rs2511369450, rs2511369505, rs2511369618, rs377767386, rs2511384558, rs2511374731, rs2511374326, rs2511374597 View all (93 more)	RCV004995731 RCV000115881 RCV004558764 RCV000129151 RCV000129707 View all (111 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Intellectual disability	Pathogenic; Likely pathogenic	rs281875322, rs397518413	RCV001260808 RCV005625264	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Juvenile polyposis of stomach	Pathogenic	rs377767334	RCV000009069	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Juvenile polyposis syndrome	Likely pathogenic; Pathogenic	rs2144451738, rs1555686624, rs2144401809, rs2144418764, rs2144419362, rs2144427739, rs2144446385, rs2144478377, rs2144429392, rs587780124, rs2144405621, rs2144402036, rs2144405369, rs2144427357, rs377767348 View all (140 more)	RCV001377145 RCV001379228 RCV001388316 RCV001391007 RCV001386065 View all (159 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Juvenile polyposis/hereditary hemorrhagic telangiectasia syndrome	Likely pathogenic; Pathogenic	rs1909899495, rs1555686624, rs587780124, rs2144402036, rs2144478656, rs2144427288, rs80338965, rs730881952, rs377767334, rs2144478869, rs80338963, rs121912580, rs876660720, rs2511391289, rs2511374416 View all (48 more)	RCV001335262 RCV004037636 RCV004019614 RCV004046640 RCV003464193 View all (63 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Moyamoya angiopathy	Likely pathogenic; Pathogenic	rs397518413	RCV004703205	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Myhre syndrome	Pathogenic; Likely pathogenic	rs80338965, rs2511369618, rs2511367483, rs2511377408, rs377767347, rs281875321, rs281875322, rs281875320, rs1555686624, rs397518413	RCV000768095 RCV003314038 RCV003314204 RCV003387574 RCV000763030 View all (5 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Neoplasm	Likely pathogenic; Pathogenic	rs1568211588, rs2144407451, rs80338963, rs876658694, rs2144401076, rs80338964, rs377767331, rs377767347, rs377767360, rs730881954	RCV005233072 RCV005233065 RCV005229772 RCV004668854 RCV006274444 View all (5 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Neurodevelopmental delay	Pathogenic	rs281875322	RCV001375955	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
SMAD4-related disorder	Likely pathogenic; Pathogenic	rs377767348, rs80338965, rs80338963, rs281875321, rs281875322, rs1060500741, rs397518413	RCV003402038 RCV004745209 RCV003924819 RCV005249996 RCV004745165 RCV003899904 RCV003398656 View all (2 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Squamous cell lung carcinoma	Pathogenic	rs1060500740	RCV005899435	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Thrombocytopenia	Pathogenic	rs771084683	RCV001270577	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (51)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BMPR1A-RELATED JUVENILE POLYPOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRACHYDACTYLY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, DUCTAL, BREAST	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLANGIOCARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COGNITION DISORDERS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	-	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRANIOFACIAL ABNORMALITIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DELIRIUM, DEMENTIA, AMNESTIC, COGNITIVE DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA, VASCULAR	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Early age onset of sporadic thoracic aortic dissections	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Conflicting classifications of pathogenicity; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Uncertain significance; Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar ClinVar, Orphanet ClinVar, Orphanet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Gastrointestinal polyposis	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GROWTH MENTAL DEFICIENCY SYNDROME OF MYHRE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary hemorrhagic telangiectasia	Conflicting classifications of pathogenicity	ClinVar Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Heritable Thoracic Aortic Disease	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heritable thoracic aortic disease without juvenile polyposis and hereditary hemorrhagic telangiectasia	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Isolated thoracic aortic aneurysm	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Juvenile Polyposis	Likely benign; Uncertain significance; Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES, PARASITIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; confers sensitivity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYNCH SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of breast	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MARFAN SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephroblastoma	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign; Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CANCER	—	HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary arterial hypertension	Conflicting classifications of pathogenicity	ClinVar ClinGen, Disgenet ClinGen, Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Pulmonary hypertension, primary, 1	Likely benign; Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Telangiectasia, hereditary hemorrhagic, type 1	Likely benign; Uncertain significance; Benign; Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular dementia	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (574)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
2-3 toe syndactyly	Syndactyly Of The Toes	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Actinic keratosis	Actinic keratosis	BEFREE	22301403, 23648546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	24457081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	12443883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	25161335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10408907, 10415848, 10623651, 10626800, 10980115, 11323508, 11751510, 12429655, 12640108, 12720172, 14647445, 14669329, 15157044, 15736060, 15855639 View all (21 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	12720172, 14647445, 15157044, 15367885, 15736060, 17854080, 19064568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	15063137, 25742737, 29673545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	16368780, 8813122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	CTD_human_DG	23525077, 24952744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25890228, 28852126, 30413663, 31054158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CLINVAR_DG	26619011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	10769633, 11553622, 11751510, 14508516, 14657708, 15084978, 15929091, 17349581, 17436386, 17854080, 19584151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	CLINVAR_DG	26619011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	CLINVAR_DG	26619011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	29958137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	10340381, 10626800, 11196469, 12469138, 12640108, 16699851, 18245538, 20682711, 22115830, 27708166, 29986996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	10559252, 11197776, 15814628, 16192307, 22115830, 29113300, 9506519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	11196469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	11891193, 24102952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	19266212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	39622643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anal carcinoma	Anal Cancer	BEFREE	11598481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	29986996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	22331366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	32398773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	34185228	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	27783321		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	16320109, 19856310, 21492076, 22504380, 22869556, 22945649, 23470568, 23552743, 24386371, 24625091, 24709776, 26284758, 26397140, 26530532, 26676757 View all (17 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	26586478, 30836094, 33747255, 34298235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	28716708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	30210120, 34185955	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	23239472	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Thoracic	Aortic Aneurysm	BEFREE	28666732, 28716708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic coarctation	Aortic Coarctation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Diseases	Aortic Diseases	BEFREE	23239472, 30809044		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Dissection	Aortic dissection	Pubtator	23239472, 28666732, 30779466, 30809044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	Pubtator	24424121	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	11891193, 24102952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	29434729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations	Arteriovenous malformations	Pubtator	23239472, 24525918, 30210120, 39939156	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations, Cerebral	Cerebral arteriovenous malformation	BEFREE	20019187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	26215036, 32998457, 34079550	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	37175608	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	BEFREE	31229977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atypical Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	31293968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31398665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	16368780, 24952744	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	21305538	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	8813122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	15042598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign tumor of pancreas	Benign Tumor Of Pancreas	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bile duct carcinoma	Bile duct carcinoma	BEFREE	15573254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bile Duct Diseases	Bile duct disease	Pubtator	34987644	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Bile duct neoplasms	Pubtator	36088360	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	10719364, 12168833, 15014009, 28693246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	29360550, 30908307, 39803868	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	23226455, 29231261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blepharophimosis	Blepharophimosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Blepharoptosis	Ptosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bmpr1a-Related Juvenile Polyposis	Polyposis	BEFREE	16152648		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bmpr1a-Related Juvenile Polyposis	Polyposis	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bone Diseases	Bone Disease	BEFREE	25029242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brachydactyly	Brachydactyly	CTD_human_DG	22158539		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brachydactyly	Brachydactyly	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain neoplasms	Pubtator	35796015	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10415848, 10487520, 11809701, 12414627, 15645498, 15886208, 16489022, 16627986, 17523142, 19752858, 19943940, 20734429, 21448710, 21835029, 22875853 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12576474, 16438724, 16627986, 17695423, 19752858, 19943940, 21835029, 23022998, 23047509, 23053665, 23975369, 26040677, 26504170, 26920143, 27270325 View all (6 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31681835	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	11062049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cakut	Congenital anomalies of kidney and urinary tract	BEFREE	29197384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cakut	Congenital anomalies of the kidney and urinary tract	Pubtator	29197384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
CAPILLARY MALFORMATION-ARTERIOVENOUS MALFORMATION 2	Capillary Malformation-Arteriovenous Malformation	BEFREE	30760892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	10092624, 10871368, 11337365, 14669329, 14695784, 15637742, 16135802, 16368780, 16478646, 18460020, 18507057, 19686287, 21835029, 26449823, 27929028 View all (11 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12237773, 17023741, 18664273, 20307265, 22799322	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	33037134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoid, Goblet Cell	Carcinoma	BEFREE	14681318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10327057, 10340381, 10340387, 10436786, 10623651, 10719364, 10766191, 10980115, 11196469, 11215281, 11283934, 11337365, 11351300, 11408925, 11553622 View all (40 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	15154643	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	16627986, 19943940	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	12010891	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	16438724, 23975369	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	10490821, 10878024, 16489684, 16617361, 18644981, 21289291, 22799322, 25068270, 26817584, 27023146, 30915745, 36635499	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	26317919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23226455, 29231261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11401430, 18620728, 25893305, 28199217, 28370334, 30185897, 30416386, 31322230, 8665501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	21799915, 28060758, 32366274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	10980115, 15696124, 20473902, 31569425	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	11696422, 15154643, 15855639, 18310076, 21768661, 22351431, 22646265, 22869556, 23360922, 24228110, 24465802, 24709776, 25119169, 25240578, 26284758 View all (40 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33932757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	15736400, 29512734, 29980281, 30446465, 36357817	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	22301403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	12649207, 18714391, 20065949, 21540640, 21799915, 28145479, 28393199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Pancreatic Ductal	Pancreatic Ductal Carcinoma	BEFREE	11391801, 11787853, 15084978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	23239472	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	15154643, 28291966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular Abnormalities	BEFREE	27302097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	30210120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	29749509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	29749509	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	32785988	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30744395		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	12894231, 15531914, 18425078, 27748903		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	29434970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	11745435, 12894231, 15531914, 18425078, 27748903, 29434970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	16767220, 28490009		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Cholangiocarcinoma	CTD_human_DG	22561520		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	25536104, 26077733, 27009864, 30170977, 30908307, 34987644, 35726602, 35897137, 37184679, 37222808, 39273408	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	34799729, 37488750	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	35897137, 36252869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholecystitis	Cholecystitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis, Extrahepatic	Cholestasis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	26339396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28984049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	29924446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Class III malocclusion	Malocclusion	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Clinodactyly	Clinodactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Clinodactyly of fingers	Clinodactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	CTD_human_DG	22158539		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	BEFREE	12237237, 29977289, 9155588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11357936, 12077092, 14520001, 15899814, 18059158, 19284991, 19478385, 19571605, 19909744, 20331650, 20442291, 21245094, 21964812, 25680269, 25742737 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	18426856, 28179590	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	11021814	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	12077092, 18426856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	12077092, 20307265, 21492476, 28714374, 31073530, 32949121	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17151782, 17478078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	16613914, 23399955, 38146137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10340381, 10389752, 10446110, 10479724, 10665650, 10993648, 11159190, 11172591, 11357936, 11481457, 11553622, 12077092, 12237773, 12500293, 12569386 View all (87 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	16144935, 20565773, 25944804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10446110, 10665650, 10781087, 11021814, 11040453, 11481457, 12237773, 12500293, 12569386, 14715079, 15637742, 16135802, 16769811, 17088901, 18059158 View all (79 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CLINVAR_DG	10479724, 10775259, 12821112, 14715079, 17994767, 26619011, 8898652, 9679244		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	10698524, 11197776, 16135802, 17390050, 20622003, 20707908, 9506519		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12077092, 16739311, 16886611, 19183329, 19686287, 20682711, 21245094, 32767323	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12569386, 14715079, 15063137, 16082587, 17390050		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	16144935, 20565773, 25944804		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	15031030, 20685751, 25432397, 29460088, 29976569, 30571376, 30744395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Camptodactyly	Congenital Camptodactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	24532422, 25536104, 25693006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	31229977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital pulmonary arteriovenous malformation	Congenital Pulmonary Arteriovenous Malformation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital small ears	Microtia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Conjunctival telangiectasis	Conjunctival Telangiectasis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Constipation	Constipation	Pubtator	20565773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16337851, 20073064, 25482028, 27779660, 28901475, 31640193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	30210120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	33506919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	32432764	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	29967250, 30730996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	29977289, 30636020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	31968593	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyanosis	Cyanosis	Pubtator	23794345	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Deaf Mutism	Deafness	CTD_human_DG	22158539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deafness, Acquired	Deafness	CTD_human_DG	22158539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	24939082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	22079283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	10665650	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	14607700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	22821565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	33428109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	27686408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27686408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	30914061	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17167985, 30914061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	27686408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	34742256	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorder of macula of retina	Disorder Of Macula Of Retina	BEFREE	22683461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	30779466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	23975369, 24639398, 29483830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	10980115, 16627986, 29483830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	LHGDN	16627986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductus Arteriosus Patent	Patent ductus arteriosus	Pubtator	34002944	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Duodenal polyposis	Duodenal polyposis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	28167493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	CLINVAR_DG	15031030, 16613914, 17873119, 22158539, 22243968, 22581936, 22585601, 22846733, 24398790, 24424121, 24715504, 26420300, 27562837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	24102952	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	17016646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	10331746, 15385128, 22266936, 31293968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	21771027, 22266936, 33053339	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	25228630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	32524577	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epispadias	Epispadias	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	21799915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	10789724, 25554686, 8957088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	CLINVAR_DG	26619011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	15726543	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	25554686, 8957088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	25554686, 34725559, 37445849	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	10789724, 12209716, 15736400, 30880778, 33760133, 34218518, 36056599, 9197523	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	29866946	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Varices	Esophageal varix	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	25856002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	25856002	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	21709185	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Exocrine pancreatic insufficiency	Exocrine pancreatic insufficiency	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	CTD_human_DG	22561520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	26077733, 27622582, 30908307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	26878210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	26336083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	21289624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	23525077, 24077944, 24952744, 30355311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial pancreatic carcinoma	Pancreatic Carcinoma	Orphanet			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Familial primary pulmonary hypertension	Pulmonary Hypertension	GENOMICS_ENGLAND_DG	29650961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial thoracic aortic aneurysm and aortic dissection	Thoracic Aortic Aneurysm And Aortic Dissection	ORPHANET_DG	30809044		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Familial thoracic aortic aneurysm and aortic dissection	Thoracic Aortic Aneurysm And Aortic Dissection	Orphanet			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Familial thoracic aortic aneurysm and aortic dissection	Thoracic Aortic Aneurysm And Aortic Dissection	GENOMICS_ENGLAND_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Fanconi Anemia	Fanconi Anemia	BEFREE	19841536		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	19841536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29696816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	12629129, 14604812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29601129, 29924446, 29957876, 30119204, 30711634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicle stimulating hormone deficiency	Follicle Stimulating Hormone Deficiency	BEFREE	29800110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicle-stimulating hormone deficiency, isolated	Follicle stimulating hormone deficiency	BEFREE	29800110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular Cyst	Follicular cyst	Pubtator	32415058	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	12692194, 14607700, 15573254, 28693246, 30614799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	18158568, 30427539, 39803868	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	15736060, 24659668, 30946932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	CLINVAR_DG	26619011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrinoma	Gastrinoma	BEFREE	10327057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	36809082	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Hemorrhage	Gastrointestinal hemorrhage	Pubtator	36809082	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	11920286, 16613914, 22243968, 33058509, 33303972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	9582123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized juvenile polyposis/juvenile polyposis coli	Polyposis Coli	Orphanet			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Genital Neoplasms, Female	Genital Neoplasms, Female	BEFREE	31569186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	10706106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	22722999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	26747772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29158223, 29861845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	29158223, 31432189	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29158223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	21791112, 25639227, 29861845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	21791112	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35251569, 37081231	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	24424121, 29230941	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth mental deficiency syndrome of Myhre	Myhre syndrome	Pubtator	22243968, 24398790, 24424121, 29230941, 32917212, 33369056, 33428109, 34143683, 34236823, 34433528, 35907855, 36194927	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hamartoma	Hamartoma	BEFREE	11355940, 23430953, 23805267, 25554686, 26169059, 30196345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	11156385, 16292097, 29977289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartomatous polyposis	Hamartomatous polyposis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	19841536, 26925973, 28522603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	26925973, 35144669	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	34433528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	34433528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	32432764	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Septal Defects	Heart Septal Defects	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma, Cavernous	Hemangioma, Cavernous	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	20565773, 23468366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	35680374	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	34168644	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	21105199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary hemorrhagic telangiectasia	Hereditary Hemorrhagic Telangiectasia	BEFREE	15031030, 16613914, 19270816, 20101697, 20685751, 22810475, 23794345, 24525918, 26572829, 28874282, 29460088, 29720405, 29976569, 30251589, 30571376, 30744395 View all (1 more)		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Hereditary hemorrhagic telangiectasia	Hereditary Hemorrhagic Telangiectasia	GENOMICS_ENGLAND_DG	15754356		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Hereditary hemorrhagic telangiectasia	Hereditary Hemorrhagic Telangiectasia	Orphanet			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	10340381, 11159190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Pancreatitis	Pubtator	19064568, 22046087	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Sensory and Autonomic Neuropathies	Hereditary sensory and autonomic neuropathy	Pubtator	21709185	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hernia, Femoral	Hernia, Femoral	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperopia	Hyperopia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism	Hyperparathyroidism	BEFREE	23242522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	38146137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplastic polyposis syndrome	Hyperplastic Polyposis Syndrome	BEFREE	21476993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	35898699	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	35406794	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoalbuminemia	Hypoalbuminemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplasia of the maxilla	Hypoplasia of the maxilla	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoproteinemia	Hypoproteinemia	BEFREE	28340255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21289291	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23794345, 32432764	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37175608	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	18792970, 27038547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	GENOMICS_ENGLAND_DG	29650961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	GENOMICS_ENGLAND_DG	29650961		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	14638911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	32524577	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29977289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	35426367	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	10327057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	26134418	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	20442291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	30730996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Polyposis	Intestinal polyposis	Pubtator	23399955, 23805267, 36049049, 37816352	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Polyposis	Intestinal Polyposis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Pseudo-Obstruction	Intestinal Pseudoobstruction	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	35908967	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	10980115, 11352305, 27732578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	16917866, 23981608, 27009864, 27622582, 29309301, 29698701, 30170977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	CTD_human_DG	22561520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	15154643, 19943940, 28288473, 28291966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	CTD_human_DG	20565773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	29434729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron-Refractory Iron Deficiency Anemia	Anemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Islet Cell Tumor	Islet Cell Tumor	BEFREE	14657708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile gastrointestinal polyposis	Gastrointestinal Polyposis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile polyp	Polyp	BEFREE	10811127, 15447767, 19266212, 21412070, 26169059, 26171675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Polyposis Coli	Juvenile polyposis syndrome	CLINGEN_DG	14534577, 15235019, 25680269, 9482899, 9506519, 9545410, 9582123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Polyposis Coli	Juvenile polyposis syndrome	ORPHANET_DG	18823382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Polyposis Coli	Juvenile polyposis syndrome	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
JUVENILE POLYPOSIS OF STOMACH	Juvenile polyposis syndrome	CLINGEN_DG	14534577, 15235019, 25680269, 9482899, 9506519, 9545410, 9582123		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
JUVENILE POLYPOSIS OF STOMACH	Juvenile polyposis syndrome	ORPHANET_DG	18823382		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
JUVENILE POLYPOSIS OF STOMACH	Juvenile polyposis syndrome	CTD_human_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Juvenile polyposis syndrome	Polyposis Syndrome	BEFREE	10441006, 10455879, 10479724, 10764709, 10797267, 11156385, 11352305, 11355940, 11536076, 11583957, 11741830, 11920286, 12136244, 12417513, 12630959 View all (57 more)		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Juvenile polyposis syndrome	Polyposis Syndrome	CLINVAR_DG	10764709, 10797267, 11583957, 12821112, 14526373, 15014009, 15031030, 15235019, 16152648, 16287957, 16436638, 16613914, 17362581, 17873119, 18178612 View all (27 more)		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Juvenile polyposis syndrome	Polyposis Syndrome	UNIPROT_DG	12417513, 9811934		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Juvenile polyposis syndrome	Polyposis Syndrome	CLINGEN_DG	14534577, 15235019, 25680269, 9482899, 9506519, 9545410, 9582123		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Juvenile polyposis syndrome	Polyposis Syndrome	GENOMICS_ENGLAND_DG	15754356, 16246179		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Juvenile polyposis syndrome	Polyposis Syndrome	ORPHANET_DG	18823382		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Juvenile polyposis syndrome	Polyposis Syndrome	CTD_human_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
JUVENILE POLYPOSIS/HEREDITARY HEMORRHAGIC TELANGIECTASIA SYNDROME (disorder)	Juvenile polyposis syndrome	GENOMICS_ENGLAND_DG	15031030, 16246179, 21465659, 25931195, 29650961		★★★★★ ★☆☆☆☆ Found in Text Mining only
JUVENILE POLYPOSIS/HEREDITARY HEMORRHAGIC TELANGIECTASIA SYNDROME (disorder)	Juvenile polyposis syndrome	UNIPROT_DG	15031030		★★★★★ ★☆☆☆☆ Found in Text Mining only
JUVENILE POLYPOSIS/HEREDITARY HEMORRHAGIC TELANGIECTASIA SYNDROME (disorder)	Juvenile polyposis syndrome	BEFREE	16613914, 20101697, 23239472, 26165824, 26572829, 30809044		★★★★★ ★☆☆☆☆ Found in Text Mining only
JUVENILE POLYPOSIS/HEREDITARY HEMORRHAGIC TELANGIECTASIA SYNDROME (disorder)	Juvenile polyposis syndrome	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
JUVENILE POLYPOSIS/HEREDITARY HEMORRHAGIC TELANGIECTASIA SYNDROME (disorder)	Juvenile polyposis syndrome	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	30636020	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	23591200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leigh Disease	Leigh syndrome	Pubtator	29103024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leigh syndrome French Canadian type	Leigh syndrome	Pubtator	28608966	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11244507, 21471525, 25229333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	19066393, 25229333, 30208330	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	30208330	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	25161335	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	12443883, 16865698, 21471525, 22028478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	28256094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lhermitte-Duclos disease	Lhermitte-Duclos disease	BEFREE	29434746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	25424420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	30824765	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10490821, 12378510, 15455231, 17546056, 18949401, 22241220, 23913306, 23922662, 25068270, 25531314, 26392315, 26817584, 28415588, 28445968, 29690860 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	29924446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	36482069	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	35908967	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	29690860	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	18949401, 28734833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lumbar disc disease	Lumbar Disc Disease	BEFREE	29434746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24236184, 30185897, 33199824, 35373505, 38233864	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	25893305, 9328171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	17692120, 22860091, 24272204, 25890228, 31684910	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	19341727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22278155, 33794845, 37648039	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	35456495	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	19841536, 26925973, 28522603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10487520, 11809701, 15645498, 15886208, 16489022, 16627986, 17523142, 19752858, 20734429, 21448710, 21835029, 22875853, 23053665, 23975369, 27270325 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	15385128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	15867212, 25554686, 8957088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	15573254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	16613914, 17546056, 18949401, 20101697, 22243968, 25389115, 27006499, 8957088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10822381, 11401430, 18174241, 18620728, 25893305, 28199217, 28370334, 30185897, 30416386, 31322230, 8665501, 8971158, 9466656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	25424420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	12649207, 16951150, 18714391, 19916025, 20065949, 21540640, 21799915, 28145479, 28393199, 8653691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10408907, 10436811, 10487520, 10623651, 10766191, 10769633, 10781087, 10810347, 10862198, 10975709, 10993648, 11040453, 11115575, 11278805, 11751405 View all (64 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15042598, 16260274, 16550207, 18213629, 21289624, 22341455, 23538390, 24272204, 24504368, 24708576, 26259043, 28417919, 29113300, 29331421, 29352019 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	18618014, 22243968, 22301403, 23648546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15736060, 17873119, 19341727, 21105199, 22020746, 22821565, 26494556, 27006499, 27438138, 27685626, 28440445, 29103082, 29572117, 30873576, 9331080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	21105199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	29864900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	21874046, 22109972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23226455, 29231261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10436786, 10623651, 11115575, 11196171, 11352305, 11481457, 11751510, 12168833, 12237237, 12414627, 12548549, 12618756, 12821112, 15014009, 15314162 View all (67 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	12894231, 15531914, 18425078, 27748903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10559252, 11357936, 12077092, 14520001, 15899814, 18059158, 19284991, 19478385, 19571605, 20331650, 20442291, 21245094, 21964812, 23393589, 25680269 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Ductal Carcinoma	Marfan Syndrome	CTD_human_DG	20565773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11809701, 15886208, 9150356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16172383, 16627986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CLINVAR_DG	26619011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	23239472	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medullary Neoplasms	Medullary Neoplasms	BEFREE	11159190		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	24127404, 29731876, 31039140		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	11304690, 28340489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	28340489	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	12499916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	37175608	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29051557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Methylmalonic acidemia	Methylmalonic acidemia	Pubtator	35680374	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Microstomia	Microstomia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	31491041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	36731340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	21093933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	21093933	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	9644295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myhre syndrome	Myhre Syndrome	GENOMICS_ENGLAND_DG	20735985, 22158539, 24896178		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Myhre syndrome	Myhre Syndrome	BEFREE	22158539, 22683461, 22711472, 24398790, 24424121, 24580733, 24715504, 27302097, 27562837, 29230941, 31595668, 31654632, 31837202		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Myhre syndrome	Myhre Syndrome	ORPHANET_DG	22158539, 22243968, 24398790, 24580733, 24715504		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Myhre syndrome	Myhre Syndrome	CTD_human_DG	22158539		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Myhre syndrome	Myhre Syndrome	UNIPROT_DG	22158539, 22243968		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Myhre syndrome	Myhre Syndrome	CLINVAR_DG	22158539, 24424121, 24715504		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Myhre syndrome	Myhre Syndrome	Orphanet			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Myocardial Infarction	Myocardial Infarction	BEFREE	30317569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	33506919, 35908967	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	CTD_human_DG	22158539		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopathy	Myopathy	BEFREE	29183317		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	20416076, 31328403	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	29960168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm of small intestine	Intestinal Neoplasms	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10331746, 10340387, 10389752, 10415848, 10436786, 10449972, 10451707, 10479724, 10487520, 10502325, 10559252, 10623651, 10626800, 10665650, 10698524 View all (257 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplastic Syndromes, Hereditary	Hereditary Cancer Syndrome	CLINVAR_DG	10441006, 10479724, 10764709, 10797267, 11274206, 12417513, 15031030, 15235019, 16152648, 16436638, 17873119, 18178612, 20101697, 20685751, 21465659 View all (20 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	17336183, 20044608		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrolithiasis	Nephrolithiasis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	27595937, 9288786, 9464509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	22586144, 27816207, 30730996, 31319641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	30276464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	18174241, 18620728, 25893305, 26187928, 26307684, 26818357, 27279345, 28199217, 28577946, 28631567, 29745043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	29696816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	LHGDN	15173084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24424121, 33053339	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	35898699	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	29800110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	34669172	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta	Osteogenesis Imperfecta	BEFREE	24006258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	26329309	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29167750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	26329309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	26947069, 28055015, 29290978, 29528777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	28055015, 28670958	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	21540640, 38297261	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	12649207, 18714391, 20065949, 21540640, 21799915, 28145479, 28393199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11438451, 18714391, 19996292, 21540640, 21799915, 25894377, 27875625, 28145479, 30720057, 32276544, 32641411, 34163033, 34747309	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20797318	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10092624, 10408907, 10436786, 10487520, 10623651, 10766191, 10810347, 10862198, 10880379, 10975709, 10993648, 11040453, 11115575, 11278805, 11751405 View all (56 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma, familial	Pancreatic carcinoma	ORPHANET_DG	25240578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma, familial	Pancreatic carcinoma	BEFREE	9098646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Cyst	Pancreatic cyst	Pubtator	26253305	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	BEFREE	14607700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	11751510, 16320109, 19270646, 19901970, 22504380, 23344532, 23470568, 24625091, 24859161, 28099419, 28160547, 28339284, 28983662, 30212393, 30497813 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	10327057, 11553622, 14639103, 16135802, 17349581, 19901970, 20622003, 24625091, 26046433, 27089513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	11783110, 15014009, 15846069, 18519681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	10092624, 10623651, 10880379, 10980115, 11040453, 11161385, 12140283, 12379307, 12569386, 14695784, 14715079, 15696124, 15855639, 16135802, 18239055 View all (65 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	10993648, 11021814, 11323508, 14669329, 19064568, 19686287	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis	Pancreatitis	BEFREE	17436386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	17436386	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	12120000, 14607700, 17436386, 20531246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	22109972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	23242522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	21742805, 28720843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pericarditis	Pericarditis	Pubtator	24424121	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peutz-Jeghers Syndrome	Peutz-Jeghers Syndrome	BEFREE	11215281, 11355940		★★★★★ ★☆☆☆☆ Found in Text Mining only
PNEUMOTHORAX, PRIMARY SPONTANEOUS	Pneumothorax	BEFREE	29707331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	31735954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	37930517	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	30251589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polydactyly	Polydactyly	BEFREE	31654632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyposis, Gastric	Gastric polyposis	BEFREE	12136244, 16613914, 25389115, 26159157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyposis, Gastric	Gastric polyposis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Precocious Puberty	Precocious puberty	BEFREE	31654632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precocious Puberty	Precocious puberty	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Prelingual Deafness	Deafness	CTD_human_DG	22158539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15042598, 16260274, 16550207, 18213629, 21289624, 22341455, 23538390, 24272204, 24504368, 24708576, 26206483, 26259043, 28417919, 29113300, 29331421 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12226080, 15042598, 18213629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12226080, 17965617, 23538390, 24200968, 24504368, 26444865, 26469352, 28417919, 37550764	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24272204	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	29924446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	24424121, 35346192	Associate	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Pulmonary arterial hypertension	Pulmonary arterial hypertension	GENOMICS_ENGLAND_DG	29650961		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Pulmonary arterial hypertension	Pulmonary arterial hypertension	HPO_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Pulmonary Arteriovenous Fistulas	Pulmonary Arteriovenous Fistulas	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	23877858, 35898699	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	24307592, 29943845, 30988750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	18245538, 21068203, 21964812, 28267766, 31056731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal polyp	Rectal Polyp	BEFREE	25389115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal polyp	Rectal Polyp	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	15107966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16337851, 20073064, 22326755, 25482028, 28901475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	21927575, 25236771, 30114247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	34143683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal telangiectasia	Retinal telangiectasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	22683461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	27229858, 9572475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	17016646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	20219075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	11021814	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	35898699	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	BEFREE	29958137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	24457081		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	31242417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia, Childhood	Schizophrenia	BEFREE	31242417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	12847691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Limited	Scleroderma	Pubtator	35907855	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	21609932, 29703253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	10706106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Shprintzen-Goldberg syndrome	Shprintzen-Goldberg Syndrome	BEFREE	23103230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	24525918	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	37175608	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Smad4-Related Juvenile Polyposis	Polyposis	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	30413663, 38233864	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Specific learning disability	Specific Learning Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Spontaneous hematomas	Hematomas	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10810347, 18618014, 19875416, 20852387, 21170261, 22301403, 23999427, 27748903, 27835902, 29206939, 29934328, 30575147, 31118804, 31140647, 31189369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15867212, 16478646, 17023741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	10995883, 20012971, 22314103, 30741461, 30880778, 9197523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	16478646, 17023741, 25275298, 25980437, 26046389, 30001742, 34498800	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23826135, 24425785	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	28852126, 31209059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	23648546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	15867212, 16478646, 19841536, 19841540, 21705453, 25275298, 26046389, 28126323, 28522603, 30575147, 8653689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	CLINVAR_DG	26619011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of vulva	Carcinoma Of Vulva	BEFREE	29512734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12692839, 15736060, 17873119, 19341727, 21105199, 22020746, 22821565, 26494556, 27006499, 27438138, 27685626, 28440445, 28617917, 29103082, 29572117, 30873576, 9197522, 9331080 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	18355998	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15033661		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	15288293, 17873119, 18507057, 21105199, 22710759, 24659668, 25372287, 26846663, 27383203, 27438138, 27685626, 28440445, 28617917, 31949278, 32481437 View all (4 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	21105199		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	33458917	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Strabismus	Strabismus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	23468366, 30251589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Submucous cleft of hard palate	Submucosal cleft palate	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	12847691, 16319104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Telangiectasia Hereditary Hemorrhagic	Hereditary hemorrhagic telangiectasia	Pubtator	15994879, 16613914, 16690726, 17873119, 19270816, 22553411, 22991266, 23239472, 23722869, 23794345, 23805858, 24525918, 26165824, 29147802, 29243366 View all (19 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of fallot	Pubtator	29230941	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thoracic Diseases	Thoracic disease	Pubtator	23239472, 28666732, 30809044, 39596629	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	14687032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymic Carcinoma	Thymic Carcinoma	BEFREE	29645059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	29645059		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	23591524	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	21874046, 22109972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	15940269, 21874046, 22109972, 26079547, 28351340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	35264071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29955155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	30653987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23226455, 31238579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neurogenic	Neurogenic bladder	Pubtator	35662268	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	29684357	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	CLINVAR_DG	26619011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	18425078, 28401751, 35008475	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	12629129, 14604812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	23972370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	22243968	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
VATER association	Vacterl association	Pubtator	36049049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	30210120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Visceral angiomatosis	Visceral angiomatosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner syndrome	Pubtator	33428109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SMAD4 (SMAD family member 4)