Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	4087
Gene name	SMAD family member 2
Gene symbol	SMAD2
Synonyms (NCBI Gene)	CHTD8JV18JV18-1LDS6MADH2MADR2hMAD-2hSMAD2
Chromosome	18
Chromosome location	18q21.1
Summary	The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene `mothers against decapentaplegic` (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional mo

Show/Hide all (5)

SNP ID	Visualize variation	Clinical significance	Consequence
rs797044882	C>G	Pathogenic	Missense variant, genic downstream transcript variant, coding sequence variant
rs1064793873	C>A	Pathogenic	5 prime UTR variant, stop gained, coding sequence variant
rs1131691755	A>T	Pathogenic	Genic upstream transcript variant, 5 prime UTR variant, stop gained, coding sequence variant
rs1555658568	C>T	Likely-pathogenic	Genic upstream transcript variant, stop gained, coding sequence variant, 5 prime UTR variant
rs1598802389	->GG	Pathogenic	Coding sequence variant, 5 prime UTR variant, frameshift variant

1114

Show/Hide all (1114)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005872	hsa-miR-155-5p	Luciferase reporter assayqRT-PCRWestern blot	21036908
MIRT005872	hsa-miR-155-5p	Luciferase reporter assayqRT-PCRWestern blot	21036908
MIRT005872	hsa-miR-155-5p	Luciferase reporter assayqRT-PCRWestern blot	21036908
MIRT005872	hsa-miR-155-5p	Luciferase reporter assayqRT-PCRWestern blot	21036908
MIRT007290	hsa-miR-200a-3p	Luciferase reporter assay	22020340
MIRT007290	hsa-miR-200a-3p	Luciferase reporter assay	22020340
MIRT007322	hsa-miR-200b-3p	Luciferase reporter assay	23492772
MIRT005872	hsa-miR-155-5p	Reporter assay;Western blot	21036908
MIRT005872	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT043212	hsa-miR-324-5p	CLASH	23622248
MIRT042141	hsa-miR-484	CLASH	23622248
MIRT039468	hsa-miR-652-3p	CLASH	23622248
MIRT005872	hsa-miR-155-5p	qRT-PCRWestern blot	22426647
MIRT053419	hsa-miR-624-3p	Microarray	23807165
MIRT005872	hsa-miR-155-5p	Luciferase reporter assayqRT-PCRWestern blot	22426647
MIRT005872	hsa-miR-155-5p	Luciferase reporter assayqRT-PCRWestern blot	22426647
MIRT053560	hsa-miR-148a-3p	Luciferase reporter assayqRT-PCRWestern blot	23873106
MIRT053687	hsa-miR-181a-5p	Microarray	22942087
MIRT053699	hsa-miR-188-5p	Microarray	22942087
MIRT053419	hsa-miR-624-3p	Microarray	22942087
MIRT054772	hsa-miR-146a-5p	qRT-PCRWestern blot	24892945
MIRT387527	hsa-miR-18b-5p	Luciferase reporter assayqRT-PCRWestern blot	23916701
MIRT387526	hsa-miR-18a-5p	MicroarrayLuciferase reporter assay	24664294
MIRT387526	hsa-miR-18a-5p	MicroarrayLuciferase reporter assay	24664294
MIRT387527	hsa-miR-18b-5p	Luciferase reporter assayqRT-PCRWestern blot	23916701
MIRT387526	hsa-miR-18a-5p	MicroarrayLuciferase reporter assay	24664294
MIRT387526	hsa-miR-18a-5p	MicroarrayLuciferase reporter assay	24664294
MIRT724470	hsa-miR-2115-3p	HITS-CLIP	19536157
MIRT724469	hsa-miR-4502	HITS-CLIP	19536157
MIRT724468	hsa-miR-4757-5p	HITS-CLIP	19536157
MIRT724467	hsa-miR-6744-3p	HITS-CLIP	19536157
MIRT724466	hsa-miR-361-5p	HITS-CLIP	19536157
MIRT724465	hsa-miR-5089-3p	HITS-CLIP	19536157
MIRT724464	hsa-miR-374a-3p	HITS-CLIP	19536157
MIRT699175	hsa-miR-548av-3p	HITS-CLIP	23313552
MIRT699174	hsa-miR-548g-3p	HITS-CLIP	23313552
MIRT699173	hsa-miR-5680	HITS-CLIP	23313552
MIRT699172	hsa-miR-1324	HITS-CLIP	23313552
MIRT699171	hsa-miR-203a-3p	HITS-CLIP	23313552
MIRT699170	hsa-miR-5702	HITS-CLIP	23313552
MIRT699169	hsa-miR-505-3p	HITS-CLIP	23313552
MIRT699168	hsa-miR-937-5p	HITS-CLIP	23313552
MIRT699167	hsa-miR-106a-3p	HITS-CLIP	23313552
MIRT612467	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT612466	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT612465	hsa-miR-8485	HITS-CLIP	23824327
MIRT628988	hsa-miR-503-5p	HITS-CLIP	23824327
MIRT612464	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT612463	hsa-miR-6072	HITS-CLIP	23824327
MIRT612462	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT612467	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT612466	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT612465	hsa-miR-8485	HITS-CLIP	23824327
MIRT628988	hsa-miR-503-5p	HITS-CLIP	23824327
MIRT612464	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT612463	hsa-miR-6072	HITS-CLIP	23824327
MIRT612462	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT495412	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT666212	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT666211	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT666210	hsa-miR-371a-5p	HITS-CLIP	23824327
MIRT666209	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT666208	hsa-miR-4469	HITS-CLIP	23824327
MIRT666207	hsa-miR-196a-3p	HITS-CLIP	23824327
MIRT666206	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT612467	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT612466	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT612465	hsa-miR-8485	HITS-CLIP	23824327
MIRT628988	hsa-miR-503-5p	HITS-CLIP	23824327
MIRT612464	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT612463	hsa-miR-6072	HITS-CLIP	23824327
MIRT612462	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT612467	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT612466	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT612465	hsa-miR-8485	HITS-CLIP	23824327
MIRT628988	hsa-miR-503-5p	HITS-CLIP	23824327
MIRT612464	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT612463	hsa-miR-6072	HITS-CLIP	23824327
MIRT612462	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT612467	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT612466	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT612465	hsa-miR-8485	HITS-CLIP	23824327
MIRT612464	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT612463	hsa-miR-6072	HITS-CLIP	23824327
MIRT612462	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT612467	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT612466	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT612465	hsa-miR-8485	HITS-CLIP	23824327
MIRT612464	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT612463	hsa-miR-6072	HITS-CLIP	23824327
MIRT612462	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT612467	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT612466	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT612465	hsa-miR-8485	HITS-CLIP	23824327
MIRT628988	hsa-miR-503-5p	HITS-CLIP	23824327
MIRT612464	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT612463	hsa-miR-6072	HITS-CLIP	23824327
MIRT612462	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT612467	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT612466	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT612465	hsa-miR-8485	HITS-CLIP	23824327
MIRT612464	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT612463	hsa-miR-6072	HITS-CLIP	23824327
MIRT612462	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT612467	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT612466	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT612465	hsa-miR-8485	HITS-CLIP	23824327
MIRT612464	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT612463	hsa-miR-6072	HITS-CLIP	23824327
MIRT612462	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT612467	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT612466	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT612465	hsa-miR-8485	HITS-CLIP	23824327
MIRT612464	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT612463	hsa-miR-6072	HITS-CLIP	23824327
MIRT612462	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT495414	hsa-miR-495-5p	PAR-CLIP	23708386
MIRT495412	hsa-miR-3613-3p	PAR-CLIP	23708386
MIRT495411	hsa-miR-6501-5p	PAR-CLIP	23708386
MIRT495410	hsa-miR-192-3p	PAR-CLIP	23708386
MIRT005872	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT005872	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT726493	hsa-miR-27a-3p	HITS-CLIP	22473208
MIRT726494	hsa-miR-27b-3p	HITS-CLIP	22473208
MIRT731256	hsa-miR-323a-3p	CFPAC-1	26908446
MIRT731256	hsa-miR-323a-3p	CFPAC-1	26908446
MIRT731256	hsa-miR-323a-3p	Luciferase reporter assay	26908446
MIRT731256	hsa-miR-323a-3p	Luciferase reporter assay	26908446
MIRT731928	hsa-miR-128-3p	Luciferase reporter assay	27087048
MIRT731928	hsa-miR-128-3p	Luciferase reporter assay	27087048
MIRT731928	hsa-miR-128-3p	Luciferase reporter assay	27087048
MIRT731928	hsa-miR-128-3p	Luciferase reporter assay	27087048
MIRT732219	hsa-miR-425-5p	Luciferase reporter assayqRT-PCRWestern blot	26674378
MIRT732219	hsa-miR-425-5p	Luciferase reporter assayqRT-PCRWestern blot	26674378
MIRT053560	hsa-miR-148a-3p	FlowImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot	26983401
MIRT053560	hsa-miR-148a-3p	FlowImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot	26983401
MIRT053560	hsa-miR-148a-3p	FlowImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot	26983401
MIRT053560	hsa-miR-148a-3p	FlowImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot	26983401
MIRT726494	hsa-miR-27b-3p	Luciferase reporter assayWestern blot	28095798
MIRT726494	hsa-miR-27b-3p	Luciferase reporter assayWestern blot	28095798
MIRT726494	hsa-miR-27b-3p	Luciferase reporter assayWestern blot	28095798
MIRT726494	hsa-miR-27b-3p	Luciferase reporter assayWestern blot	28095798
MIRT726494	hsa-miR-27b-3p	Luciferase reporter assayWestern blot	28095798
MIRT726494	hsa-miR-27b-3p	Luciferase reporter assayWestern blot	28095798
MIRT726494	hsa-miR-27b-3p	Luciferase reporter assayWestern blot	28095798
MIRT731256	hsa-miR-323a-3p	qRT-PCR	27059796
MIRT042141	hsa-miR-484	GFP reporter assayWestern blot	28286418
MIRT042141	hsa-miR-484	GFP reporter assayWestern blot	28286418
MIRT006613	hsa-miR-18a-5p	Luciferase reporter assay	27641158
MIRT006613	hsa-miR-18a-5p	Luciferase reporter assay	27641158
MIRT006613	hsa-miR-18a-5p	Luciferase reporter assay	27641158
MIRT006613	hsa-miR-18a-5p	Luciferase reporter assay	27641158
MIRT006613	hsa-miR-18a-5p	Luciferase reporter assay	27641158
MIRT006613	hsa-miR-18a-5p	Luciferase reporter assay	27641158
MIRT006613	hsa-miR-18a-5p	Luciferase reporter assay	27641158
MIRT006613	hsa-miR-18a-5p	Luciferase reporter assay	27641158
MIRT006613	hsa-miR-18a-5p	Luciferase reporter assay	27641158
MIRT006613	hsa-miR-18a-5p	Luciferase reporter assay	27641158
MIRT006613	hsa-miR-18a-5p	Luciferase reporter assay	27641158
MIRT006613	hsa-miR-18a-5p	Luciferase reporter assay	27641158
MIRT006613	hsa-miR-18a-5p	Luciferase reporter assay	27641158
MIRT006613	hsa-miR-18a-5p	Luciferase reporter assay	27641158
MIRT006613	hsa-miR-18a-5p	Luciferase reporter assay	27641158
MIRT726493	hsa-miR-27a-3p	Luciferase reporter assayqRT-PCRWestern blot	28370334
MIRT726493	hsa-miR-27a-3p	Luciferase reporter assayqRT-PCRWestern blot	28370334
MIRT053560	hsa-miR-148a-3p	Luciferase reporter assayqRT-PCRWestern blot	26106521
MIRT053560	hsa-miR-148a-3p	Luciferase reporter assayqRT-PCRWestern blot	26106521
MIRT053560	hsa-miR-148a-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	25980823
MIRT733503	hsa-miR-210-3p	Luciferase reporter assayqRT-PCRWestern blotting	34109429
MIRT733503	hsa-miR-210-3p	Luciferase reporter assayqRT-PCRWestern blotting	34109429
MIRT733503	hsa-miR-210-3p	Luciferase reporter assayqRT-PCRWestern blotting	34109429
MIRT733547	hsa-miR-486-3p	ImmunofluorescenceImmunoprecipitaion (IP)Luciferase reporter assayqRT-PCRWestern blotting	34080770
MIRT005872	hsa-miR-155-5p	qRT-PCR	32507875
MIRT734386	hsa-miR-497-5p	qRT-PCR	34185228
MIRT735067	hsa-miR-27a-5p	Luciferase reporter assayWestern blottingMicroarrayImmunofluorescenceqRT-PCRFlow cytometry	32790210
MIRT612466	hsa-miR-329-3p	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)Immunohistochemistry (IHC)qRT-PCR	31663517
MIRT735691	hsa-miR-382-3p	Western blottingImmunofluorescenceqRT-PCR	33114016
MIRT495412	hsa-miR-3613-3p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)ImmunofluorescenceqRT-PCR	33330073
MIRT053560	hsa-miR-148a-3p	Luciferase reporter assayImmunoprecipitaion (IP)Immunohistochemistry (IHC)In situ hybridization	32746934
MIRT724470	hsa-miR-2115-3p	HITS-CLIP	19536157
MIRT724469	hsa-miR-4502	HITS-CLIP	19536157
MIRT724468	hsa-miR-4757-5p	HITS-CLIP	19536157
MIRT724467	hsa-miR-6744-3p	HITS-CLIP	19536157
MIRT724466	hsa-miR-361-5p	HITS-CLIP	19536157
MIRT724465	hsa-miR-5089-3p	HITS-CLIP	19536157
MIRT724464	hsa-miR-374a-3p	HITS-CLIP	19536157
MIRT699175	hsa-miR-548av-3p	HITS-CLIP	23313552
MIRT699174	hsa-miR-548g-3p	HITS-CLIP	23313552
MIRT699173	hsa-miR-5680	HITS-CLIP	23313552
MIRT699172	hsa-miR-1324	HITS-CLIP	23313552
MIRT699171	hsa-miR-203a-3p	HITS-CLIP	23313552
MIRT699170	hsa-miR-5702	HITS-CLIP	23313552
MIRT699169	hsa-miR-505-3p	HITS-CLIP	23313552
MIRT699168	hsa-miR-937-5p	HITS-CLIP	23313552
MIRT699167	hsa-miR-106a-3p	HITS-CLIP	23313552
MIRT612467	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT612466	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT612465	hsa-miR-8485	HITS-CLIP	23824327
MIRT628988	hsa-miR-503-5p	HITS-CLIP	23824327
MIRT612464	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT612463	hsa-miR-6072	HITS-CLIP	23824327
MIRT612462	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT612467	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT612466	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT612465	hsa-miR-8485	HITS-CLIP	23824327
MIRT628988	hsa-miR-503-5p	HITS-CLIP	23824327
MIRT612464	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT612463	hsa-miR-6072	HITS-CLIP	23824327
MIRT612462	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT495412	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT666212	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT666211	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT666210	hsa-miR-371a-5p	HITS-CLIP	23824327
MIRT666209	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT666208	hsa-miR-4469	HITS-CLIP	23824327
MIRT666207	hsa-miR-196a-3p	HITS-CLIP	23824327
MIRT666206	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT612467	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT612466	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT612465	hsa-miR-8485	HITS-CLIP	23824327
MIRT628988	hsa-miR-503-5p	HITS-CLIP	23824327
MIRT612464	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT612463	hsa-miR-6072	HITS-CLIP	23824327
MIRT612462	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT612467	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT612466	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT612465	hsa-miR-8485	HITS-CLIP	23824327
MIRT628988	hsa-miR-503-5p	HITS-CLIP	23824327
MIRT612464	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT612463	hsa-miR-6072	HITS-CLIP	23824327
MIRT612462	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT612467	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT612466	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT612465	hsa-miR-8485	HITS-CLIP	23824327
MIRT612464	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT612463	hsa-miR-6072	HITS-CLIP	23824327
MIRT612462	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT612467	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT612466	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT612465	hsa-miR-8485	HITS-CLIP	23824327
MIRT612464	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT612463	hsa-miR-6072	HITS-CLIP	23824327
MIRT612462	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT612467	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT612466	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT612465	hsa-miR-8485	HITS-CLIP	23824327
MIRT628988	hsa-miR-503-5p	HITS-CLIP	23824327
MIRT612464	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT612463	hsa-miR-6072	HITS-CLIP	23824327
MIRT612462	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT612467	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT612466	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT612465	hsa-miR-8485	HITS-CLIP	23824327
MIRT612464	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT612463	hsa-miR-6072	HITS-CLIP	23824327
MIRT612462	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT612467	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT612466	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT612465	hsa-miR-8485	HITS-CLIP	23824327
MIRT612464	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT612463	hsa-miR-6072	HITS-CLIP	23824327
MIRT612462	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT612467	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT612466	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT612465	hsa-miR-8485	HITS-CLIP	23824327
MIRT612464	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT612463	hsa-miR-6072	HITS-CLIP	23824327
MIRT612462	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT495414	hsa-miR-495-5p	PAR-CLIP	23708386
MIRT495412	hsa-miR-3613-3p	PAR-CLIP	23708386
MIRT495411	hsa-miR-6501-5p	PAR-CLIP	23708386
MIRT495410	hsa-miR-192-3p	PAR-CLIP	23708386
MIRT755645	hsa-miR-582-3p	Luciferase reporter assay	35386287
MIRT005872	hsa-miR-155-5p	Luciferase reporter assayWestern blottingqRT-PCR	37274158
MIRT734386	hsa-miR-497-5p	qRT-PCR	34185228
MIRT1370408	hsa-miR-1182	CLIP-seq
MIRT1370409	hsa-miR-1202	CLIP-seq
MIRT1370410	hsa-miR-1207-3p	CLIP-seq
MIRT1370411	hsa-miR-1224-5p	CLIP-seq
MIRT1370412	hsa-miR-1243	CLIP-seq
MIRT1370413	hsa-miR-1244	CLIP-seq
MIRT1370414	hsa-miR-1261	CLIP-seq
MIRT1370415	hsa-miR-1278	CLIP-seq
MIRT1370416	hsa-miR-1279	CLIP-seq
MIRT1370417	hsa-miR-1294	CLIP-seq
MIRT1370418	hsa-miR-1299	CLIP-seq
MIRT1370419	hsa-miR-132	CLIP-seq
MIRT1370420	hsa-miR-1470	CLIP-seq
MIRT1370421	hsa-miR-155	CLIP-seq
MIRT1370422	hsa-miR-15a	CLIP-seq
MIRT1370423	hsa-miR-15b	CLIP-seq
MIRT1370424	hsa-miR-16	CLIP-seq
MIRT1370425	hsa-miR-181a	CLIP-seq
MIRT1370426	hsa-miR-181b	CLIP-seq
MIRT1370427	hsa-miR-181c	CLIP-seq
MIRT1370428	hsa-miR-181d	CLIP-seq
MIRT1370429	hsa-miR-1827	CLIP-seq
MIRT1370430	hsa-miR-190	CLIP-seq
MIRT1370431	hsa-miR-190b	CLIP-seq
MIRT1370432	hsa-miR-1915	CLIP-seq
MIRT1370433	hsa-miR-195	CLIP-seq
MIRT1370434	hsa-miR-200b	CLIP-seq
MIRT1370435	hsa-miR-200c	CLIP-seq
MIRT1370436	hsa-miR-212	CLIP-seq
MIRT1370437	hsa-miR-214	CLIP-seq
MIRT1370438	hsa-miR-2467-5p	CLIP-seq
MIRT1370439	hsa-miR-25	CLIP-seq
MIRT1370440	hsa-miR-2964a-5p	CLIP-seq
MIRT1370441	hsa-miR-298	CLIP-seq
MIRT1370442	hsa-miR-30a	CLIP-seq
MIRT1370443	hsa-miR-30b	CLIP-seq
MIRT1370444	hsa-miR-30c	CLIP-seq
MIRT1370445	hsa-miR-30d	CLIP-seq
MIRT1370446	hsa-miR-30e	CLIP-seq
MIRT1370447	hsa-miR-3120-3p	CLIP-seq
MIRT1370448	hsa-miR-3124-3p	CLIP-seq
MIRT1370449	hsa-miR-3135b	CLIP-seq
MIRT1370450	hsa-miR-3174	CLIP-seq
MIRT1370451	hsa-miR-3188	CLIP-seq
MIRT1370452	hsa-miR-3194-5p	CLIP-seq
MIRT1370453	hsa-miR-32	CLIP-seq
MIRT1370454	hsa-miR-3200-3p	CLIP-seq
MIRT1370455	hsa-miR-323-3p	CLIP-seq
MIRT1370456	hsa-miR-33a	CLIP-seq
MIRT1370457	hsa-miR-33b	CLIP-seq
MIRT1370458	hsa-miR-3606	CLIP-seq
MIRT1370459	hsa-miR-3619-5p	CLIP-seq
MIRT1370460	hsa-miR-363	CLIP-seq
MIRT1370461	hsa-miR-365	CLIP-seq
MIRT1370462	hsa-miR-3654	CLIP-seq
MIRT1370463	hsa-miR-3663-5p	CLIP-seq
MIRT1370464	hsa-miR-367	CLIP-seq
MIRT1370465	hsa-miR-3689a-3p	CLIP-seq
MIRT1370466	hsa-miR-3689a-5p	CLIP-seq
MIRT1370467	hsa-miR-3689b	CLIP-seq
MIRT1370468	hsa-miR-3689c	CLIP-seq
MIRT1370469	hsa-miR-3689e	CLIP-seq
MIRT1370470	hsa-miR-3689f	CLIP-seq
MIRT1370471	hsa-miR-371-5p	CLIP-seq
MIRT1370472	hsa-miR-371b-5p	CLIP-seq
MIRT1370473	hsa-miR-377	CLIP-seq
MIRT1370474	hsa-miR-3908	CLIP-seq
MIRT1370475	hsa-miR-3915	CLIP-seq
MIRT1370476	hsa-miR-3919	CLIP-seq
MIRT1370477	hsa-miR-3926	CLIP-seq
MIRT1370478	hsa-miR-3928	CLIP-seq
MIRT1370479	hsa-miR-3929	CLIP-seq
MIRT1370480	hsa-miR-3972	CLIP-seq
MIRT1370481	hsa-miR-3975	CLIP-seq
MIRT1370482	hsa-miR-410	CLIP-seq
MIRT1370483	hsa-miR-424	CLIP-seq
MIRT1370484	hsa-miR-425	CLIP-seq
MIRT1370485	hsa-miR-4261	CLIP-seq
MIRT1370486	hsa-miR-4262	CLIP-seq
MIRT1370487	hsa-miR-429	CLIP-seq
MIRT1370488	hsa-miR-4290	CLIP-seq
MIRT1370489	hsa-miR-4307	CLIP-seq
MIRT1370490	hsa-miR-4316	CLIP-seq
MIRT1370491	hsa-miR-4318	CLIP-seq
MIRT1370492	hsa-miR-433	CLIP-seq
MIRT1370493	hsa-miR-4419b	CLIP-seq
MIRT1370494	hsa-miR-4422	CLIP-seq
MIRT1370495	hsa-miR-4428	CLIP-seq
MIRT1370496	hsa-miR-4436a	CLIP-seq
MIRT1370497	hsa-miR-4461	CLIP-seq
MIRT1370498	hsa-miR-4476	CLIP-seq
MIRT1370499	hsa-miR-4478	CLIP-seq
MIRT1370500	hsa-miR-4490	CLIP-seq
MIRT1370501	hsa-miR-4503	CLIP-seq
MIRT1370502	hsa-miR-4520a-3p	CLIP-seq
MIRT1370503	hsa-miR-4527	CLIP-seq
MIRT1370504	hsa-miR-4533	CLIP-seq
MIRT1370505	hsa-miR-455-3p	CLIP-seq
MIRT1370506	hsa-miR-4649-3p	CLIP-seq
MIRT1370507	hsa-miR-4679	CLIP-seq
MIRT1370508	hsa-miR-4684-5p	CLIP-seq
MIRT1370509	hsa-miR-4687-5p	CLIP-seq
MIRT1370510	hsa-miR-4689	CLIP-seq
MIRT1370511	hsa-miR-4693-5p	CLIP-seq
MIRT1370512	hsa-miR-4700-3p	CLIP-seq
MIRT1370513	hsa-miR-4717-3p	CLIP-seq
MIRT1370514	hsa-miR-4726-3p	CLIP-seq
MIRT1370515	hsa-miR-4728-5p	CLIP-seq
MIRT1370516	hsa-miR-4756-3p	CLIP-seq
MIRT1370517	hsa-miR-4771	CLIP-seq
MIRT1370518	hsa-miR-4773	CLIP-seq
MIRT1370519	hsa-miR-4786-5p	CLIP-seq
MIRT1370520	hsa-miR-4793-5p	CLIP-seq
MIRT1370521	hsa-miR-485-5p	CLIP-seq
MIRT1370522	hsa-miR-496	CLIP-seq
MIRT1370523	hsa-miR-497	CLIP-seq
MIRT1370524	hsa-miR-502-5p	CLIP-seq
MIRT1370525	hsa-miR-513a-5p	CLIP-seq
MIRT1370526	hsa-miR-520a-5p	CLIP-seq
MIRT1370527	hsa-miR-520d-5p	CLIP-seq
MIRT1370528	hsa-miR-524-5p	CLIP-seq
MIRT1370529	hsa-miR-525-5p	CLIP-seq
MIRT1370530	hsa-miR-545	CLIP-seq
MIRT1370531	hsa-miR-548c-3p	CLIP-seq
MIRT1370532	hsa-miR-548s	CLIP-seq
MIRT1370533	hsa-miR-562	CLIP-seq
MIRT1370534	hsa-miR-569	CLIP-seq
MIRT1370535	hsa-miR-580	CLIP-seq
MIRT1370536	hsa-miR-601	CLIP-seq
MIRT1370537	hsa-miR-642a	CLIP-seq
MIRT1370538	hsa-miR-656	CLIP-seq
MIRT1370539	hsa-miR-671-5p	CLIP-seq
MIRT1370540	hsa-miR-761	CLIP-seq
MIRT1370541	hsa-miR-875-3p	CLIP-seq
MIRT1370542	hsa-miR-877	CLIP-seq
MIRT1370543	hsa-miR-892a	CLIP-seq
MIRT1370544	hsa-miR-921	CLIP-seq
MIRT1370545	hsa-miR-92a	CLIP-seq
MIRT1370546	hsa-miR-92b	CLIP-seq
MIRT1370408	hsa-miR-1182	CLIP-seq
MIRT1370547	hsa-miR-1183	CLIP-seq
MIRT1370548	hsa-miR-1236	CLIP-seq
MIRT1370413	hsa-miR-1244	CLIP-seq
MIRT1370549	hsa-miR-1245	CLIP-seq
MIRT1370550	hsa-miR-1264	CLIP-seq
MIRT1370551	hsa-miR-1270	CLIP-seq
MIRT1370552	hsa-miR-1276	CLIP-seq
MIRT1370416	hsa-miR-1279	CLIP-seq
MIRT1370553	hsa-miR-141	CLIP-seq
MIRT1370554	hsa-miR-18a	CLIP-seq
MIRT1370555	hsa-miR-18b	CLIP-seq
MIRT1370556	hsa-miR-200a	CLIP-seq
MIRT1370557	hsa-miR-2053	CLIP-seq
MIRT1370558	hsa-miR-2117	CLIP-seq
MIRT1370559	hsa-miR-24	CLIP-seq
MIRT1370439	hsa-miR-25	CLIP-seq
MIRT1370440	hsa-miR-2964a-5p	CLIP-seq
MIRT1370441	hsa-miR-298	CLIP-seq
MIRT1370560	hsa-miR-3065-5p	CLIP-seq
MIRT1370448	hsa-miR-3124-3p	CLIP-seq
MIRT1370561	hsa-miR-3143	CLIP-seq
MIRT1370562	hsa-miR-3153	CLIP-seq
MIRT1370563	hsa-miR-3158-5p	CLIP-seq
MIRT1370564	hsa-miR-3178	CLIP-seq
MIRT1370451	hsa-miR-3188	CLIP-seq
MIRT1370453	hsa-miR-32	CLIP-seq
MIRT1370456	hsa-miR-33a	CLIP-seq
MIRT1370457	hsa-miR-33b	CLIP-seq
MIRT1370565	hsa-miR-3607-5p	CLIP-seq
MIRT1370460	hsa-miR-363	CLIP-seq
MIRT1370566	hsa-miR-3646	CLIP-seq
MIRT1370464	hsa-miR-367	CLIP-seq
MIRT1370567	hsa-miR-3692	CLIP-seq
MIRT1370568	hsa-miR-3714	CLIP-seq
MIRT1370476	hsa-miR-3919	CLIP-seq
MIRT1370477	hsa-miR-3926	CLIP-seq
MIRT1370479	hsa-miR-3929	CLIP-seq
MIRT1370569	hsa-miR-3941	CLIP-seq
MIRT1370570	hsa-miR-4273	CLIP-seq
MIRT1370571	hsa-miR-4284	CLIP-seq
MIRT1370572	hsa-miR-4418	CLIP-seq
MIRT1370493	hsa-miR-4419b	CLIP-seq
MIRT1370573	hsa-miR-4426	CLIP-seq
MIRT1370574	hsa-miR-4427	CLIP-seq
MIRT1370575	hsa-miR-4457	CLIP-seq
MIRT1370499	hsa-miR-4478	CLIP-seq
MIRT1370576	hsa-miR-4486	CLIP-seq
MIRT1370577	hsa-miR-4505	CLIP-seq
MIRT1370503	hsa-miR-4527	CLIP-seq
MIRT1370578	hsa-miR-4531	CLIP-seq
MIRT1370579	hsa-miR-4643	CLIP-seq
MIRT1370580	hsa-miR-4647	CLIP-seq
MIRT1370581	hsa-miR-466	CLIP-seq
MIRT1370582	hsa-miR-4662b	CLIP-seq
MIRT1370583	hsa-miR-4668-3p	CLIP-seq
MIRT1370584	hsa-miR-4668-5p	CLIP-seq
MIRT1370585	hsa-miR-4672	CLIP-seq
MIRT1370508	hsa-miR-4684-5p	CLIP-seq
MIRT1370586	hsa-miR-4703-3p	CLIP-seq
MIRT1370587	hsa-miR-4728-3p	CLIP-seq
MIRT1370588	hsa-miR-4731-3p	CLIP-seq
MIRT1370589	hsa-miR-4735-3p	CLIP-seq
MIRT1370590	hsa-miR-4753-3p	CLIP-seq
MIRT1370591	hsa-miR-4761-5p	CLIP-seq
MIRT1370592	hsa-miR-4762-5p	CLIP-seq
MIRT1370518	hsa-miR-4773	CLIP-seq
MIRT1370519	hsa-miR-4786-5p	CLIP-seq
MIRT1370593	hsa-miR-4789-3p	CLIP-seq
MIRT1370520	hsa-miR-4793-5p	CLIP-seq
MIRT1370594	hsa-miR-4801	CLIP-seq
MIRT1370524	hsa-miR-502-5p	CLIP-seq
MIRT1370595	hsa-miR-505	CLIP-seq
MIRT1370596	hsa-miR-509-3-5p	CLIP-seq
MIRT1370597	hsa-miR-509-5p	CLIP-seq
MIRT1370527	hsa-miR-520d-5p	CLIP-seq
MIRT1370528	hsa-miR-524-5p	CLIP-seq
MIRT1370598	hsa-miR-543	CLIP-seq
MIRT1370530	hsa-miR-545	CLIP-seq
MIRT1370599	hsa-miR-548a-5p	CLIP-seq
MIRT1370600	hsa-miR-548ab	CLIP-seq
MIRT1370601	hsa-miR-548ac	CLIP-seq
MIRT1370602	hsa-miR-548ae	CLIP-seq
MIRT1370603	hsa-miR-548aj	CLIP-seq
MIRT1370604	hsa-miR-548ak	CLIP-seq
MIRT1370605	hsa-miR-548am	CLIP-seq
MIRT1370606	hsa-miR-548an	CLIP-seq
MIRT1370607	hsa-miR-548b-5p	CLIP-seq
MIRT1370531	hsa-miR-548c-3p	CLIP-seq
MIRT1370608	hsa-miR-548c-5p	CLIP-seq
MIRT1370609	hsa-miR-548d-3p	CLIP-seq
MIRT1370610	hsa-miR-548d-5p	CLIP-seq
MIRT1370611	hsa-miR-548h	CLIP-seq
MIRT1370612	hsa-miR-548i	CLIP-seq
MIRT1370613	hsa-miR-548j	CLIP-seq
MIRT1370614	hsa-miR-548k	CLIP-seq
MIRT1370615	hsa-miR-548l	CLIP-seq
MIRT1370532	hsa-miR-548s	CLIP-seq
MIRT1370616	hsa-miR-548w	CLIP-seq
MIRT1370617	hsa-miR-548x	CLIP-seq
MIRT1370618	hsa-miR-548y	CLIP-seq
MIRT1370619	hsa-miR-548z	CLIP-seq
MIRT1370620	hsa-miR-559	CLIP-seq
MIRT1370621	hsa-miR-620	CLIP-seq
MIRT1370622	hsa-miR-624	CLIP-seq
MIRT1370623	hsa-miR-645	CLIP-seq
MIRT1370624	hsa-miR-873	CLIP-seq
MIRT1370542	hsa-miR-877	CLIP-seq
MIRT1370545	hsa-miR-92a	CLIP-seq
MIRT1370546	hsa-miR-92b	CLIP-seq
MIRT1370625	hsa-miR-940	CLIP-seq
MIRT1370626	hsa-miR-942	CLIP-seq
MIRT1553854	hsa-miR-548aa	CLIP-seq
MIRT2109962	hsa-miR-142-5p	CLIP-seq
MIRT2109963	hsa-miR-183	CLIP-seq
MIRT1370441	hsa-miR-298	CLIP-seq
MIRT2109964	hsa-miR-3145-5p	CLIP-seq
MIRT2109965	hsa-miR-3160-5p	CLIP-seq
MIRT2109966	hsa-miR-340	CLIP-seq
MIRT2109967	hsa-miR-345	CLIP-seq
MIRT2109968	hsa-miR-3614-5p	CLIP-seq
MIRT1370567	hsa-miR-3692	CLIP-seq
MIRT2109969	hsa-miR-4256	CLIP-seq
MIRT1370572	hsa-miR-4418	CLIP-seq
MIRT2109970	hsa-miR-452	CLIP-seq
MIRT2109971	hsa-miR-4528	CLIP-seq
MIRT2109972	hsa-miR-4635	CLIP-seq
MIRT2109973	hsa-miR-4676-3p	CLIP-seq
MIRT2109974	hsa-miR-4719	CLIP-seq
MIRT1370591	hsa-miR-4761-5p	CLIP-seq
MIRT2109975	hsa-miR-4762-3p	CLIP-seq
MIRT2109976	hsa-miR-4778-5p	CLIP-seq
MIRT1370519	hsa-miR-4786-5p	CLIP-seq
MIRT1370596	hsa-miR-509-3-5p	CLIP-seq
MIRT1370597	hsa-miR-509-5p	CLIP-seq
MIRT1370530	hsa-miR-545	CLIP-seq
MIRT2109977	hsa-miR-603	CLIP-seq
MIRT2109978	hsa-miR-935	CLIP-seq
MIRT2109979	hsa-miR-943	CLIP-seq
MIRT1370412	hsa-miR-1243	CLIP-seq
MIRT1370419	hsa-miR-132	CLIP-seq
MIRT2109980	hsa-miR-145	CLIP-seq
MIRT1370436	hsa-miR-212	CLIP-seq
MIRT2109981	hsa-miR-331-5p	CLIP-seq
MIRT2109982	hsa-miR-3647-3p	CLIP-seq
MIRT2109983	hsa-miR-3658	CLIP-seq
MIRT1370474	hsa-miR-3908	CLIP-seq
MIRT1370489	hsa-miR-4307	CLIP-seq
MIRT2109984	hsa-miR-4310	CLIP-seq
MIRT1370492	hsa-miR-433	CLIP-seq
MIRT1370494	hsa-miR-4422	CLIP-seq
MIRT2109985	hsa-miR-4436b-5p	CLIP-seq
MIRT2109986	hsa-miR-450b-5p	CLIP-seq
MIRT2109970	hsa-miR-452	CLIP-seq
MIRT1370579	hsa-miR-4643	CLIP-seq
MIRT1370581	hsa-miR-466	CLIP-seq
MIRT2109973	hsa-miR-4676-3p	CLIP-seq
MIRT2109987	hsa-miR-4686	CLIP-seq
MIRT1370511	hsa-miR-4693-5p	CLIP-seq
MIRT2109988	hsa-miR-4705	CLIP-seq
MIRT2109989	hsa-miR-4717-5p	CLIP-seq
MIRT2109990	hsa-miR-4738-3p	CLIP-seq
MIRT2109991	hsa-miR-4753-5p	CLIP-seq
MIRT1370593	hsa-miR-4789-3p	CLIP-seq
MIRT2109992	hsa-miR-507	CLIP-seq
MIRT1553854	hsa-miR-548aa	CLIP-seq
MIRT1370531	hsa-miR-548c-3p	CLIP-seq
MIRT2109993	hsa-miR-557	CLIP-seq
MIRT2333314	hsa-let-7a	CLIP-seq
MIRT2333315	hsa-let-7b	CLIP-seq
MIRT2333316	hsa-let-7c	CLIP-seq
MIRT2333317	hsa-let-7d	CLIP-seq
MIRT2333318	hsa-let-7e	CLIP-seq
MIRT2333319	hsa-let-7f	CLIP-seq
MIRT2333320	hsa-let-7g	CLIP-seq
MIRT2333321	hsa-let-7i	CLIP-seq
MIRT1370408	hsa-miR-1182	CLIP-seq
MIRT1370547	hsa-miR-1183	CLIP-seq
MIRT2333322	hsa-miR-1185	CLIP-seq
MIRT1370409	hsa-miR-1202	CLIP-seq
MIRT2333323	hsa-miR-1205	CLIP-seq
MIRT1370410	hsa-miR-1207-3p	CLIP-seq
MIRT2333324	hsa-miR-1226	CLIP-seq
MIRT2333325	hsa-miR-1229	CLIP-seq
MIRT1370548	hsa-miR-1236	CLIP-seq
MIRT1370412	hsa-miR-1243	CLIP-seq
MIRT2333326	hsa-miR-1245b-5p	CLIP-seq
MIRT2333327	hsa-miR-125b	CLIP-seq
MIRT2333328	hsa-miR-1263	CLIP-seq
MIRT2333329	hsa-miR-1266	CLIP-seq
MIRT1370416	hsa-miR-1279	CLIP-seq
MIRT2333330	hsa-miR-128	CLIP-seq
MIRT2333331	hsa-miR-1285	CLIP-seq
MIRT1370417	hsa-miR-1294	CLIP-seq
MIRT2333332	hsa-miR-129-5p	CLIP-seq
MIRT2333333	hsa-miR-1302	CLIP-seq
MIRT2333334	hsa-miR-1305	CLIP-seq
MIRT1370419	hsa-miR-132	CLIP-seq
MIRT2333335	hsa-miR-1323	CLIP-seq
MIRT2333336	hsa-miR-135a	CLIP-seq
MIRT2333337	hsa-miR-135b	CLIP-seq
MIRT2109962	hsa-miR-142-5p	CLIP-seq
MIRT2109980	hsa-miR-145	CLIP-seq
MIRT2333338	hsa-miR-146a	CLIP-seq
MIRT2333339	hsa-miR-146b-5p	CLIP-seq
MIRT2333340	hsa-miR-148a	CLIP-seq
MIRT2333341	hsa-miR-148b	CLIP-seq
MIRT2333342	hsa-miR-149	CLIP-seq
MIRT2333343	hsa-miR-152	CLIP-seq
MIRT1370421	hsa-miR-155	CLIP-seq
MIRT1370429	hsa-miR-1827	CLIP-seq
MIRT2109963	hsa-miR-183	CLIP-seq
MIRT2333344	hsa-miR-197	CLIP-seq
MIRT1370434	hsa-miR-200b	CLIP-seq
MIRT1370435	hsa-miR-200c	CLIP-seq
MIRT2333345	hsa-miR-203	CLIP-seq
MIRT2333346	hsa-miR-2114	CLIP-seq
MIRT1370436	hsa-miR-212	CLIP-seq
MIRT2333347	hsa-miR-216a	CLIP-seq
MIRT2333348	hsa-miR-224	CLIP-seq
MIRT2333349	hsa-miR-2277-3p	CLIP-seq
MIRT1370559	hsa-miR-24	CLIP-seq
MIRT1370439	hsa-miR-25	CLIP-seq
MIRT2333350	hsa-miR-2682	CLIP-seq
MIRT2333351	hsa-miR-27a	CLIP-seq
MIRT2333352	hsa-miR-27b	CLIP-seq
MIRT1370440	hsa-miR-2964a-5p	CLIP-seq
MIRT1370441	hsa-miR-298	CLIP-seq
MIRT2333353	hsa-miR-3064-5p	CLIP-seq
MIRT1370442	hsa-miR-30a	CLIP-seq
MIRT1370443	hsa-miR-30b	CLIP-seq
MIRT1370444	hsa-miR-30c	CLIP-seq
MIRT1370445	hsa-miR-30d	CLIP-seq
MIRT1370446	hsa-miR-30e	CLIP-seq
MIRT2333354	hsa-miR-3117-5p	CLIP-seq
MIRT2333355	hsa-miR-3122	CLIP-seq
MIRT2333356	hsa-miR-3123	CLIP-seq
MIRT1370448	hsa-miR-3124-3p	CLIP-seq
MIRT1370449	hsa-miR-3135b	CLIP-seq
MIRT2333357	hsa-miR-3138	CLIP-seq
MIRT2333358	hsa-miR-3142	CLIP-seq
MIRT2109964	hsa-miR-3145-5p	CLIP-seq
MIRT1370562	hsa-miR-3153	CLIP-seq
MIRT2333359	hsa-miR-3167	CLIP-seq
MIRT1370564	hsa-miR-3178	CLIP-seq
MIRT2333360	hsa-miR-3180-5p	CLIP-seq
MIRT2333361	hsa-miR-3187-3p	CLIP-seq
MIRT2333362	hsa-miR-3187-5p	CLIP-seq
MIRT1370451	hsa-miR-3188	CLIP-seq
MIRT1370452	hsa-miR-3194-5p	CLIP-seq
MIRT1370453	hsa-miR-32	CLIP-seq
MIRT1370455	hsa-miR-323-3p	CLIP-seq
MIRT2333363	hsa-miR-323-5p	CLIP-seq
MIRT2109966	hsa-miR-340	CLIP-seq
MIRT2333364	hsa-miR-3545-3p	CLIP-seq
MIRT2333365	hsa-miR-3609	CLIP-seq
MIRT2333366	hsa-miR-361-3p	CLIP-seq
MIRT2333367	hsa-miR-3617	CLIP-seq
MIRT2333368	hsa-miR-3620	CLIP-seq
MIRT1370460	hsa-miR-363	CLIP-seq
MIRT1370461	hsa-miR-365	CLIP-seq
MIRT2333369	hsa-miR-3652	CLIP-seq
MIRT2333370	hsa-miR-3653	CLIP-seq
MIRT1370462	hsa-miR-3654	CLIP-seq
MIRT2109983	hsa-miR-3658	CLIP-seq
MIRT2333371	hsa-miR-3664-3p	CLIP-seq
MIRT2333372	hsa-miR-3665	CLIP-seq
MIRT1370464	hsa-miR-367	CLIP-seq
MIRT2333373	hsa-miR-3679-3p	CLIP-seq
MIRT2333374	hsa-miR-3679-5p	CLIP-seq
MIRT2333375	hsa-miR-3682-3p	CLIP-seq
MIRT1370465	hsa-miR-3689a-3p	CLIP-seq
MIRT1370466	hsa-miR-3689a-5p	CLIP-seq
MIRT1370467	hsa-miR-3689b	CLIP-seq
MIRT1370468	hsa-miR-3689c	CLIP-seq
MIRT1370469	hsa-miR-3689e	CLIP-seq
MIRT1370470	hsa-miR-3689f	CLIP-seq
MIRT1370567	hsa-miR-3692	CLIP-seq
MIRT2333376	hsa-miR-384	CLIP-seq
MIRT2333377	hsa-miR-3913-5p	CLIP-seq
MIRT2333378	hsa-miR-3914	CLIP-seq
MIRT1370475	hsa-miR-3915	CLIP-seq
MIRT1370476	hsa-miR-3919	CLIP-seq
MIRT2333379	hsa-miR-3924	CLIP-seq
MIRT2333380	hsa-miR-3925-5p	CLIP-seq
MIRT1370477	hsa-miR-3926	CLIP-seq
MIRT2333381	hsa-miR-3927	CLIP-seq
MIRT1370478	hsa-miR-3928	CLIP-seq
MIRT1370479	hsa-miR-3929	CLIP-seq
MIRT2333382	hsa-miR-3942-3p	CLIP-seq
MIRT1370480	hsa-miR-3972	CLIP-seq
MIRT2333383	hsa-miR-409-3p	CLIP-seq
MIRT1370482	hsa-miR-410	CLIP-seq
MIRT1370484	hsa-miR-425	CLIP-seq
MIRT2333384	hsa-miR-4251	CLIP-seq
MIRT2333385	hsa-miR-4252	CLIP-seq
MIRT1370485	hsa-miR-4261	CLIP-seq
MIRT2333386	hsa-miR-4263	CLIP-seq
MIRT2333387	hsa-miR-4272	CLIP-seq
MIRT2333388	hsa-miR-4276	CLIP-seq
MIRT2333389	hsa-miR-4277	CLIP-seq
MIRT2333390	hsa-miR-4280	CLIP-seq
MIRT1370571	hsa-miR-4284	CLIP-seq
MIRT1370487	hsa-miR-429	CLIP-seq
MIRT2333391	hsa-miR-4298	CLIP-seq
MIRT2333392	hsa-miR-4299	CLIP-seq
MIRT2333393	hsa-miR-4305	CLIP-seq
MIRT1370490	hsa-miR-4316	CLIP-seq
MIRT1370491	hsa-miR-4318	CLIP-seq
MIRT2333394	hsa-miR-4319	CLIP-seq
MIRT2333395	hsa-miR-4324	CLIP-seq
MIRT2333396	hsa-miR-4327	CLIP-seq
MIRT1370492	hsa-miR-433	CLIP-seq
MIRT1370572	hsa-miR-4418	CLIP-seq
MIRT1370493	hsa-miR-4419b	CLIP-seq
MIRT1370494	hsa-miR-4422	CLIP-seq
MIRT1370574	hsa-miR-4427	CLIP-seq
MIRT2333397	hsa-miR-4430	CLIP-seq
MIRT2333398	hsa-miR-4432	CLIP-seq
MIRT2333399	hsa-miR-4433	CLIP-seq
MIRT1370496	hsa-miR-4436a	CLIP-seq
MIRT2109985	hsa-miR-4436b-5p	CLIP-seq
MIRT2333400	hsa-miR-4446-5p	CLIP-seq
MIRT2333401	hsa-miR-4451	CLIP-seq
MIRT2333402	hsa-miR-4458	CLIP-seq
MIRT2333403	hsa-miR-4459	CLIP-seq
MIRT1370497	hsa-miR-4461	CLIP-seq
MIRT2333404	hsa-miR-4463	CLIP-seq
MIRT2333405	hsa-miR-4468	CLIP-seq
MIRT2333406	hsa-miR-4470	CLIP-seq
MIRT2333407	hsa-miR-4477a	CLIP-seq
MIRT1370499	hsa-miR-4478	CLIP-seq
MIRT1370576	hsa-miR-4486	CLIP-seq
MIRT1370500	hsa-miR-4490	CLIP-seq
MIRT2333408	hsa-miR-4494	CLIP-seq
MIRT2333409	hsa-miR-4499	CLIP-seq
MIRT2333410	hsa-miR-449c	CLIP-seq
MIRT2333411	hsa-miR-4500	CLIP-seq
MIRT1370501	hsa-miR-4503	CLIP-seq
MIRT1370577	hsa-miR-4505	CLIP-seq
MIRT2333412	hsa-miR-4506	CLIP-seq
MIRT2109986	hsa-miR-450b-5p	CLIP-seq
MIRT2333413	hsa-miR-4511	CLIP-seq
MIRT2333414	hsa-miR-4518	CLIP-seq
MIRT2109970	hsa-miR-452	CLIP-seq
MIRT1370502	hsa-miR-4520a-3p	CLIP-seq
MIRT2333415	hsa-miR-4521	CLIP-seq
MIRT1370503	hsa-miR-4527	CLIP-seq
MIRT2109971	hsa-miR-4528	CLIP-seq
MIRT2333416	hsa-miR-4529-5p	CLIP-seq
MIRT2333417	hsa-miR-4530	CLIP-seq
MIRT1370505	hsa-miR-455-3p	CLIP-seq
MIRT1370579	hsa-miR-4643	CLIP-seq
MIRT2333418	hsa-miR-4646-5p	CLIP-seq
MIRT1370506	hsa-miR-4649-3p	CLIP-seq
MIRT2333419	hsa-miR-4659a-3p	CLIP-seq
MIRT2333420	hsa-miR-4659b-3p	CLIP-seq
MIRT1370581	hsa-miR-466	CLIP-seq
MIRT1370584	hsa-miR-4668-5p	CLIP-seq
MIRT1370585	hsa-miR-4672	CLIP-seq
MIRT2109973	hsa-miR-4676-3p	CLIP-seq
MIRT1370507	hsa-miR-4679	CLIP-seq
MIRT2333421	hsa-miR-4683	CLIP-seq
MIRT2333422	hsa-miR-4691-3p	CLIP-seq
MIRT1370511	hsa-miR-4693-5p	CLIP-seq
MIRT2333423	hsa-miR-4696	CLIP-seq
MIRT2333424	hsa-miR-4697-3p	CLIP-seq
MIRT2109988	hsa-miR-4705	CLIP-seq
MIRT2109974	hsa-miR-4719	CLIP-seq
MIRT2333425	hsa-miR-4724-3p	CLIP-seq
MIRT2333426	hsa-miR-4724-5p	CLIP-seq
MIRT1370515	hsa-miR-4728-5p	CLIP-seq
MIRT2333427	hsa-miR-4733-3p	CLIP-seq
MIRT2333428	hsa-miR-4733-5p	CLIP-seq
MIRT2333429	hsa-miR-4735-5p	CLIP-seq
MIRT2333430	hsa-miR-4747-5p	CLIP-seq
MIRT2333431	hsa-miR-4749-3p	CLIP-seq
MIRT1370590	hsa-miR-4753-3p	CLIP-seq
MIRT1370516	hsa-miR-4756-3p	CLIP-seq
MIRT2333432	hsa-miR-4768-3p	CLIP-seq
MIRT2333433	hsa-miR-4772-5p	CLIP-seq
MIRT1370518	hsa-miR-4773	CLIP-seq
MIRT2333434	hsa-miR-4775	CLIP-seq
MIRT2333435	hsa-miR-4777-5p	CLIP-seq
MIRT1370519	hsa-miR-4786-5p	CLIP-seq
MIRT1370593	hsa-miR-4789-3p	CLIP-seq
MIRT1370520	hsa-miR-4793-5p	CLIP-seq
MIRT2333436	hsa-miR-4794	CLIP-seq
MIRT2333437	hsa-miR-4795-3p	CLIP-seq
MIRT2333438	hsa-miR-4796-5p	CLIP-seq
MIRT2333439	hsa-miR-4799-5p	CLIP-seq
MIRT1370521	hsa-miR-485-5p	CLIP-seq
MIRT2333440	hsa-miR-488	CLIP-seq
MIRT1370522	hsa-miR-496	CLIP-seq
MIRT2333441	hsa-miR-499-5p	CLIP-seq
MIRT2333442	hsa-miR-499a-5p	CLIP-seq
MIRT2109992	hsa-miR-507	CLIP-seq
MIRT2333443	hsa-miR-508-5p	CLIP-seq
MIRT1370596	hsa-miR-509-3-5p	CLIP-seq
MIRT1370597	hsa-miR-509-5p	CLIP-seq
MIRT2333444	hsa-miR-514	CLIP-seq
MIRT2333445	hsa-miR-514b-3p	CLIP-seq
MIRT2333446	hsa-miR-516a-5p	CLIP-seq
MIRT2333447	hsa-miR-518d-5p	CLIP-seq
MIRT2333448	hsa-miR-519b-5p	CLIP-seq
MIRT2333449	hsa-miR-519c-5p	CLIP-seq
MIRT1370526	hsa-miR-520a-5p	CLIP-seq
MIRT2333450	hsa-miR-520c-5p	CLIP-seq
MIRT1370527	hsa-miR-520d-5p	CLIP-seq
MIRT2333451	hsa-miR-520g	CLIP-seq
MIRT2333452	hsa-miR-520h	CLIP-seq
MIRT1370528	hsa-miR-524-5p	CLIP-seq
MIRT1370529	hsa-miR-525-5p	CLIP-seq
MIRT2333453	hsa-miR-526a	CLIP-seq
MIRT2333454	hsa-miR-541	CLIP-seq
MIRT1370530	hsa-miR-545	CLIP-seq
MIRT2333455	hsa-miR-548a-3p	CLIP-seq
MIRT1553854	hsa-miR-548aa	CLIP-seq
MIRT2333456	hsa-miR-548ah	CLIP-seq
MIRT2333457	hsa-miR-548b-3p	CLIP-seq
MIRT1370531	hsa-miR-548c-3p	CLIP-seq
MIRT2333458	hsa-miR-548e	CLIP-seq
MIRT2333459	hsa-miR-548f	CLIP-seq
MIRT2333460	hsa-miR-548o	CLIP-seq
MIRT2333461	hsa-miR-548p	CLIP-seq
MIRT1370532	hsa-miR-548s	CLIP-seq
MIRT2333462	hsa-miR-548u	CLIP-seq
MIRT2109993	hsa-miR-557	CLIP-seq
MIRT2333463	hsa-miR-566	CLIP-seq
MIRT1370534	hsa-miR-569	CLIP-seq
MIRT2333464	hsa-miR-576-5p	CLIP-seq
MIRT2333465	hsa-miR-583	CLIP-seq
MIRT2333466	hsa-miR-589	CLIP-seq
MIRT2333467	hsa-miR-590-3p	CLIP-seq
MIRT2333468	hsa-miR-595	CLIP-seq
MIRT2333469	hsa-miR-605	CLIP-seq
MIRT2333470	hsa-miR-606	CLIP-seq
MIRT2333471	hsa-miR-607	CLIP-seq
MIRT2333472	hsa-miR-612	CLIP-seq
MIRT2333473	hsa-miR-617	CLIP-seq
MIRT2333474	hsa-miR-627	CLIP-seq
MIRT2333475	hsa-miR-634	CLIP-seq
MIRT2333476	hsa-miR-641	CLIP-seq
MIRT1370623	hsa-miR-645	CLIP-seq
MIRT2333477	hsa-miR-647	CLIP-seq
MIRT2333478	hsa-miR-653	CLIP-seq
MIRT2333479	hsa-miR-654-5p	CLIP-seq
MIRT1370538	hsa-miR-656	CLIP-seq
MIRT2333480	hsa-miR-657	CLIP-seq
MIRT1370539	hsa-miR-671-5p	CLIP-seq
MIRT2333481	hsa-miR-676	CLIP-seq
MIRT2333482	hsa-miR-767-5p	CLIP-seq
MIRT1370624	hsa-miR-873	CLIP-seq
MIRT2333483	hsa-miR-876-3p	CLIP-seq
MIRT2333484	hsa-miR-876-5p	CLIP-seq
MIRT2333485	hsa-miR-885-5p	CLIP-seq
MIRT2333486	hsa-miR-889	CLIP-seq
MIRT2333487	hsa-miR-890	CLIP-seq
MIRT2333488	hsa-miR-891b	CLIP-seq
MIRT1370543	hsa-miR-892a	CLIP-seq
MIRT2333489	hsa-miR-924	CLIP-seq
MIRT1370545	hsa-miR-92a	CLIP-seq
MIRT1370546	hsa-miR-92b	CLIP-seq
MIRT2109978	hsa-miR-935	CLIP-seq
MIRT1370626	hsa-miR-942	CLIP-seq
MIRT2333490	hsa-miR-98	CLIP-seq
MIRT1370451	hsa-miR-3188	CLIP-seq
MIRT1370518	hsa-miR-4773	CLIP-seq
MIRT2333355	hsa-miR-3122	CLIP-seq
MIRT2333377	hsa-miR-3913-5p	CLIP-seq
MIRT2333430	hsa-miR-4747-5p	CLIP-seq
MIRT1370539	hsa-miR-671-5p	CLIP-seq
MIRT1370547	hsa-miR-1183	CLIP-seq
MIRT2627632	hsa-miR-1256	CLIP-seq
MIRT1370550	hsa-miR-1264	CLIP-seq
MIRT1370418	hsa-miR-1299	CLIP-seq
MIRT2627633	hsa-miR-136	CLIP-seq
MIRT1370429	hsa-miR-1827	CLIP-seq
MIRT2333345	hsa-miR-203	CLIP-seq
MIRT2333346	hsa-miR-2114	CLIP-seq
MIRT2627634	hsa-miR-2116	CLIP-seq
MIRT2627635	hsa-miR-2392	CLIP-seq
MIRT1370438	hsa-miR-2467-5p	CLIP-seq
MIRT2627636	hsa-miR-2681	CLIP-seq
MIRT2333350	hsa-miR-2682	CLIP-seq
MIRT2333355	hsa-miR-3122	CLIP-seq
MIRT2333356	hsa-miR-3123	CLIP-seq
MIRT2627637	hsa-miR-3136-3p	CLIP-seq
MIRT2333357	hsa-miR-3138	CLIP-seq
MIRT2109964	hsa-miR-3145-5p	CLIP-seq
MIRT2627638	hsa-miR-3148	CLIP-seq
MIRT2627639	hsa-miR-3156-5p	CLIP-seq
MIRT1370564	hsa-miR-3178	CLIP-seq
MIRT1370451	hsa-miR-3188	CLIP-seq
MIRT2627640	hsa-miR-3190	CLIP-seq
MIRT2627641	hsa-miR-3202	CLIP-seq
MIRT1370455	hsa-miR-323-3p	CLIP-seq
MIRT2333363	hsa-miR-323-5p	CLIP-seq
MIRT2627642	hsa-miR-325	CLIP-seq
MIRT2627643	hsa-miR-338-5p	CLIP-seq
MIRT2333367	hsa-miR-3617	CLIP-seq
MIRT2627644	hsa-miR-3622a-3p	CLIP-seq
MIRT2627645	hsa-miR-3622b-3p	CLIP-seq
MIRT2109982	hsa-miR-3647-3p	CLIP-seq
MIRT2333370	hsa-miR-3653	CLIP-seq
MIRT2109983	hsa-miR-3658	CLIP-seq
MIRT2627646	hsa-miR-3659	CLIP-seq
MIRT2627647	hsa-miR-3685	CLIP-seq
MIRT2627648	hsa-miR-3713	CLIP-seq
MIRT1370472	hsa-miR-371b-5p	CLIP-seq
MIRT2627649	hsa-miR-381	CLIP-seq
MIRT1370474	hsa-miR-3908	CLIP-seq
MIRT2333377	hsa-miR-3913-5p	CLIP-seq
MIRT1370476	hsa-miR-3919	CLIP-seq
MIRT2333379	hsa-miR-3924	CLIP-seq
MIRT1370477	hsa-miR-3926	CLIP-seq
MIRT2627650	hsa-miR-3945	CLIP-seq
MIRT1370481	hsa-miR-3975	CLIP-seq
MIRT2627651	hsa-miR-3978	CLIP-seq
MIRT1370482	hsa-miR-410	CLIP-seq
MIRT2627652	hsa-miR-421	CLIP-seq
MIRT2627653	hsa-miR-4253	CLIP-seq
MIRT2333387	hsa-miR-4272	CLIP-seq
MIRT2333389	hsa-miR-4277	CLIP-seq
MIRT2627654	hsa-miR-432	CLIP-seq
MIRT2627655	hsa-miR-4320	CLIP-seq
MIRT1370574	hsa-miR-4427	CLIP-seq
MIRT2627656	hsa-miR-4452	CLIP-seq
MIRT1370497	hsa-miR-4461	CLIP-seq
MIRT2627657	hsa-miR-4474-5p	CLIP-seq
MIRT2627658	hsa-miR-4475	CLIP-seq
MIRT2333408	hsa-miR-4494	CLIP-seq
MIRT2333410	hsa-miR-449c	CLIP-seq
MIRT2109971	hsa-miR-4528	CLIP-seq
MIRT1370504	hsa-miR-4533	CLIP-seq
MIRT1370579	hsa-miR-4643	CLIP-seq
MIRT2627659	hsa-miR-4658	CLIP-seq
MIRT1370581	hsa-miR-466	CLIP-seq
MIRT2627660	hsa-miR-4666-3p	CLIP-seq
MIRT2627661	hsa-miR-4666-5p	CLIP-seq
MIRT1370583	hsa-miR-4668-3p	CLIP-seq
MIRT2627662	hsa-miR-4670-3p	CLIP-seq
MIRT2627663	hsa-miR-4680-3p	CLIP-seq
MIRT1370508	hsa-miR-4684-5p	CLIP-seq
MIRT1370511	hsa-miR-4693-5p	CLIP-seq
MIRT2109988	hsa-miR-4705	CLIP-seq
MIRT2627664	hsa-miR-4709-5p	CLIP-seq
MIRT2627665	hsa-miR-4715-3p	CLIP-seq
MIRT2627666	hsa-miR-4729	CLIP-seq
MIRT2333428	hsa-miR-4733-5p	CLIP-seq
MIRT2627667	hsa-miR-4738-5p	CLIP-seq
MIRT2333430	hsa-miR-4747-5p	CLIP-seq
MIRT2627668	hsa-miR-4760-3p	CLIP-seq
MIRT2627669	hsa-miR-4782-5p	CLIP-seq
MIRT1370519	hsa-miR-4786-5p	CLIP-seq
MIRT1370593	hsa-miR-4789-3p	CLIP-seq
MIRT1370520	hsa-miR-4793-5p	CLIP-seq
MIRT2333437	hsa-miR-4795-3p	CLIP-seq
MIRT2333438	hsa-miR-4796-5p	CLIP-seq
MIRT2627670	hsa-miR-485-3p	CLIP-seq
MIRT1370521	hsa-miR-485-5p	CLIP-seq
MIRT2627671	hsa-miR-487b	CLIP-seq
MIRT2333443	hsa-miR-508-5p	CLIP-seq
MIRT2627672	hsa-miR-515-5p	CLIP-seq
MIRT2627673	hsa-miR-516b	CLIP-seq
MIRT2333454	hsa-miR-541	CLIP-seq
MIRT1370602	hsa-miR-548ae	CLIP-seq
MIRT1370603	hsa-miR-548aj	CLIP-seq
MIRT1370605	hsa-miR-548am	CLIP-seq
MIRT1370531	hsa-miR-548c-3p	CLIP-seq
MIRT1370532	hsa-miR-548s	CLIP-seq
MIRT1370617	hsa-miR-548x	CLIP-seq
MIRT2627674	hsa-miR-550b	CLIP-seq
MIRT2333463	hsa-miR-566	CLIP-seq
MIRT2627675	hsa-miR-570	CLIP-seq
MIRT2627676	hsa-miR-574-5p	CLIP-seq
MIRT2627677	hsa-miR-577	CLIP-seq
MIRT2627678	hsa-miR-586	CLIP-seq
MIRT2627679	hsa-miR-628-3p	CLIP-seq
MIRT2333476	hsa-miR-641	CLIP-seq
MIRT2333478	hsa-miR-653	CLIP-seq
MIRT2333479	hsa-miR-654-5p	CLIP-seq
MIRT1370538	hsa-miR-656	CLIP-seq
MIRT2627680	hsa-miR-664	CLIP-seq
MIRT1370539	hsa-miR-671-5p	CLIP-seq
MIRT2627681	hsa-miR-766	CLIP-seq
MIRT2333483	hsa-miR-876-3p	CLIP-seq
MIRT2627682	hsa-miR-888	CLIP-seq
MIRT2333486	hsa-miR-889	CLIP-seq
MIRT1370547	hsa-miR-1183	CLIP-seq
MIRT2627632	hsa-miR-1256	CLIP-seq
MIRT1370418	hsa-miR-1299	CLIP-seq
MIRT2627633	hsa-miR-136	CLIP-seq
MIRT1370429	hsa-miR-1827	CLIP-seq
MIRT2333345	hsa-miR-203	CLIP-seq
MIRT2333346	hsa-miR-2114	CLIP-seq
MIRT2627634	hsa-miR-2116	CLIP-seq
MIRT2627635	hsa-miR-2392	CLIP-seq
MIRT1370438	hsa-miR-2467-5p	CLIP-seq
MIRT2627636	hsa-miR-2681	CLIP-seq
MIRT2333350	hsa-miR-2682	CLIP-seq
MIRT2333355	hsa-miR-3122	CLIP-seq
MIRT2333356	hsa-miR-3123	CLIP-seq
MIRT2627637	hsa-miR-3136-3p	CLIP-seq
MIRT2333357	hsa-miR-3138	CLIP-seq
MIRT1370561	hsa-miR-3143	CLIP-seq
MIRT2109964	hsa-miR-3145-5p	CLIP-seq
MIRT2627638	hsa-miR-3148	CLIP-seq
MIRT2691354	hsa-miR-3155	CLIP-seq
MIRT2691355	hsa-miR-3155b	CLIP-seq
MIRT2627639	hsa-miR-3156-5p	CLIP-seq
MIRT1370564	hsa-miR-3178	CLIP-seq
MIRT1370451	hsa-miR-3188	CLIP-seq
MIRT2627640	hsa-miR-3190	CLIP-seq
MIRT2627641	hsa-miR-3202	CLIP-seq
MIRT2333363	hsa-miR-323-5p	CLIP-seq
MIRT2627642	hsa-miR-325	CLIP-seq
MIRT2627643	hsa-miR-338-5p	CLIP-seq
MIRT2333367	hsa-miR-3617	CLIP-seq
MIRT2627644	hsa-miR-3622a-3p	CLIP-seq
MIRT2627645	hsa-miR-3622b-3p	CLIP-seq
MIRT2627646	hsa-miR-3659	CLIP-seq
MIRT2627647	hsa-miR-3685	CLIP-seq
MIRT2691356	hsa-miR-3688-3p	CLIP-seq
MIRT1370465	hsa-miR-3689a-3p	CLIP-seq
MIRT1370468	hsa-miR-3689c	CLIP-seq
MIRT1370472	hsa-miR-371b-5p	CLIP-seq
MIRT2627649	hsa-miR-381	CLIP-seq
MIRT1370474	hsa-miR-3908	CLIP-seq
MIRT2333377	hsa-miR-3913-5p	CLIP-seq
MIRT1370476	hsa-miR-3919	CLIP-seq
MIRT2333379	hsa-miR-3924	CLIP-seq
MIRT1370477	hsa-miR-3926	CLIP-seq
MIRT2627650	hsa-miR-3945	CLIP-seq
MIRT1370481	hsa-miR-3975	CLIP-seq
MIRT2627651	hsa-miR-3978	CLIP-seq
MIRT1370482	hsa-miR-410	CLIP-seq
MIRT2627652	hsa-miR-421	CLIP-seq
MIRT2627653	hsa-miR-4253	CLIP-seq
MIRT2333387	hsa-miR-4272	CLIP-seq
MIRT2333389	hsa-miR-4277	CLIP-seq
MIRT2627654	hsa-miR-432	CLIP-seq
MIRT2627655	hsa-miR-4320	CLIP-seq
MIRT1370574	hsa-miR-4427	CLIP-seq
MIRT2627656	hsa-miR-4452	CLIP-seq
MIRT1370497	hsa-miR-4461	CLIP-seq
MIRT2627657	hsa-miR-4474-5p	CLIP-seq
MIRT2627658	hsa-miR-4475	CLIP-seq
MIRT2333408	hsa-miR-4494	CLIP-seq
MIRT2333410	hsa-miR-449c	CLIP-seq
MIRT1370502	hsa-miR-4520a-3p	CLIP-seq
MIRT1370504	hsa-miR-4533	CLIP-seq
MIRT2627659	hsa-miR-4658	CLIP-seq
MIRT2627660	hsa-miR-4666-3p	CLIP-seq
MIRT2627661	hsa-miR-4666-5p	CLIP-seq
MIRT1370583	hsa-miR-4668-3p	CLIP-seq
MIRT2627662	hsa-miR-4670-3p	CLIP-seq
MIRT2627663	hsa-miR-4680-3p	CLIP-seq
MIRT1370508	hsa-miR-4684-5p	CLIP-seq
MIRT1370511	hsa-miR-4693-5p	CLIP-seq
MIRT2691357	hsa-miR-4694-3p	CLIP-seq
MIRT2109988	hsa-miR-4705	CLIP-seq
MIRT2627664	hsa-miR-4709-5p	CLIP-seq
MIRT2627665	hsa-miR-4715-3p	CLIP-seq
MIRT2627666	hsa-miR-4729	CLIP-seq
MIRT2627667	hsa-miR-4738-5p	CLIP-seq
MIRT2333430	hsa-miR-4747-5p	CLIP-seq
MIRT2627669	hsa-miR-4782-5p	CLIP-seq
MIRT1370519	hsa-miR-4786-5p	CLIP-seq
MIRT1370520	hsa-miR-4793-5p	CLIP-seq
MIRT2333438	hsa-miR-4796-5p	CLIP-seq
MIRT1370521	hsa-miR-485-5p	CLIP-seq
MIRT2627671	hsa-miR-487b	CLIP-seq
MIRT2333443	hsa-miR-508-5p	CLIP-seq
MIRT2627672	hsa-miR-515-5p	CLIP-seq
MIRT2627673	hsa-miR-516b	CLIP-seq
MIRT2333454	hsa-miR-541	CLIP-seq
MIRT1370598	hsa-miR-543	CLIP-seq
MIRT1370602	hsa-miR-548ae	CLIP-seq
MIRT1370603	hsa-miR-548aj	CLIP-seq
MIRT1370605	hsa-miR-548am	CLIP-seq
MIRT1370531	hsa-miR-548c-3p	CLIP-seq
MIRT1370532	hsa-miR-548s	CLIP-seq
MIRT1370617	hsa-miR-548x	CLIP-seq
MIRT2627674	hsa-miR-550b	CLIP-seq
MIRT2333463	hsa-miR-566	CLIP-seq
MIRT2627675	hsa-miR-570	CLIP-seq
MIRT2627676	hsa-miR-574-5p	CLIP-seq
MIRT2627677	hsa-miR-577	CLIP-seq
MIRT2627678	hsa-miR-586	CLIP-seq
MIRT2627679	hsa-miR-628-3p	CLIP-seq
MIRT2333476	hsa-miR-641	CLIP-seq
MIRT2333478	hsa-miR-653	CLIP-seq
MIRT2333479	hsa-miR-654-5p	CLIP-seq
MIRT1370539	hsa-miR-671-5p	CLIP-seq
MIRT2627681	hsa-miR-766	CLIP-seq
MIRT2333483	hsa-miR-876-3p	CLIP-seq
MIRT2627682	hsa-miR-888	CLIP-seq
MIRT2333486	hsa-miR-889	CLIP-seq
MIRT2333487	hsa-miR-890	CLIP-seq

147

Show/Hide all (147)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IDA	21828274
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	9389648, 31582430
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IC	21828274
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	9389648, 31582430
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS	24964035
GO:0001657	Process	Ureteric bud development	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001706	Process	Endoderm formation	IEA
GO:0001707	Process	Mesoderm formation	IEA
GO:0001707	Process	Mesoderm formation	ISS
GO:0003002	Process	Regionalization	IEA
GO:0003140	Process	Determination of left/right asymmetry in lateral mesoderm	IMP	17239842
GO:0003180	Process	Aortic valve morphogenesis	IEA
GO:0003180	Process	Aortic valve morphogenesis	ISS
GO:0003184	Process	Pulmonary valve morphogenesis	IEA
GO:0003184	Process	Pulmonary valve morphogenesis	ISS
GO:0003203	Process	Endocardial cushion morphogenesis	IEA
GO:0003203	Process	Endocardial cushion morphogenesis	ISS
GO:0003677	Function	DNA binding	IDA	9389648
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	ISS
GO:0003700	Function	DNA-binding transcription factor activity	IDA	17438144
GO:0003700	Function	DNA-binding transcription factor activity	IDA	9389648
GO:0005160	Function	Transforming growth factor beta receptor binding	IPI	9311995
GO:0005515	Function	Protein binding	IPI	9389648, 9702198, 9865696, 9892009, 10615055, 11278756, 11387212, 11779503, 12764135, 15107821, 15231748, 15350224, 15647271, 16200078, 16751101, 17099224, 17292623, 18268325, 18511908, 18568018, 18729074, 18832382, 18923419, 19032343, 19049980, 19122240, 19135894, 19289081, 1934518
GO:0005634	Component	Nucleus	IDA	8980228, 9311995, 9389648, 12411310, 16751101, 21145499, 21599657, 25893292
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IDA	17438144
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IDA	9311995, 9389648, 12411310, 21145499
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006351	Process	DNA-templated transcription	NAS	15350224
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	35359452
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IBA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	8752209, 9311995, 9389648, 9732876, 18548003
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IMP	8980228
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	NAS	35359452
GO:0007352	Process	Zygotic specification of dorsal/ventral axis	IMP	9436979
GO:0007369	Process	Gastrulation	IEA
GO:0007369	Process	Gastrulation	IEA
GO:0007369	Process	Gastrulation	TAS	19018011
GO:0007389	Process	Pattern specification process	IEA
GO:0007492	Process	Endoderm development	IEA
GO:0007498	Process	Mesoderm development	IEA
GO:0007507	Process	Heart development	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0009653	Process	Anatomical structure morphogenesis	IBA
GO:0009749	Process	Response to glucose	IEA
GO:0009791	Process	Post-embryonic development	IEA
GO:0009880	Process	Embryonic pattern specification	IEA
GO:0009880	Process	Embryonic pattern specification	IEA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0009952	Process	Anterior/posterior pattern specification	ISS
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IEA
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	ISS
GO:0017015	Process	Regulation of transforming growth factor beta receptor signaling pathway	IMP	14555988
GO:0019902	Function	Phosphatase binding	IPI	16751101
GO:0030073	Process	Insulin secretion	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0030279	Process	Negative regulation of ossification	IDA	22155034
GO:0030324	Process	Lung development	IEA
GO:0030513	Process	Positive regulation of BMP signaling pathway	IMP	19366699
GO:0031016	Process	Pancreas development	IEA
GO:0031053	Process	Primary miRNA processing	TAS	19018011
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	19122240
GO:0032444	Component	Activin responsive factor complex	IDA	9389648
GO:0032924	Process	Activin receptor signaling pathway	IBA
GO:0032924	Process	Activin receptor signaling pathway	IMP	15150278
GO:0032924	Process	Activin receptor signaling pathway	NAS	15150278, 15350224
GO:0032991	Component	Protein-containing complex	IMP	15231848
GO:0034713	Function	Type I transforming growth factor beta receptor binding	IPI	8980228
GO:0035265	Process	Organ growth	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035556	Process	Intracellular signal transduction	ISS
GO:0038092	Process	Nodal signaling pathway	IMP	15150278, 17239842
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	11779503
GO:0045165	Process	Cell fate commitment	IEA
GO:0045165	Process	Cell fate commitment	ISS
GO:0045596	Process	Negative regulation of cell differentiation	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	14555988
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	9311995, 9389648, 9732876
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	14555988
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9389648
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046332	Function	SMAD binding	IEA
GO:0046332	Function	SMAD binding	IPI	11160896
GO:0046872	Function	Metal ion binding	IEA
GO:0048156	Function	Tau protein binding	IEA
GO:0048156	Function	Tau protein binding	ISS	24964035
GO:0048340	Process	Paraxial mesoderm morphogenesis	IEA
GO:0048340	Process	Paraxial mesoderm morphogenesis	ISS
GO:0048589	Process	Developmental growth	IEA
GO:0048617	Process	Embryonic foregut morphogenesis	IEA
GO:0048701	Process	Embryonic cranial skeleton morphogenesis	IEA
GO:0051239	Process	Regulation of multicellular organismal process	IEA
GO:0060039	Process	Pericardium development	IEA
GO:0060395	Process	SMAD protein signal transduction	IBA
GO:0060395	Process	SMAD protein signal transduction	IDA	16806156
GO:0060395	Process	SMAD protein signal transduction	IDA	9111321, 9311995, 9732876
GO:0060395	Process	SMAD protein signal transduction	IEA
GO:0060395	Process	SMAD protein signal transduction	IEA
GO:0060395	Process	SMAD protein signal transduction	IMP	17239842
GO:0060485	Process	Mesenchyme development	IEA
GO:0061450	Process	Trophoblast cell migration	IDA	34432647
GO:0061450	Process	Trophoblast cell migration	IDA	34432647
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0062009	Process	Secondary palate development	IEA
GO:0062009	Process	Secondary palate development	ISS
GO:0070410	Function	Co-SMAD binding	IPI	9111321, 9311995
GO:0070411	Function	I-SMAD binding	IBA
GO:0070411	Function	I-SMAD binding	IPI	9256479
GO:0070412	Function	R-SMAD binding	IPI	9311995
GO:0070723	Process	Response to cholesterol	IDA	17878231
GO:0071141	Component	SMAD protein complex	IDA	18832382
GO:0071142	Component	Homomeric SMAD protein complex	IPI	11779503
GO:0071144	Component	Heteromeric SMAD protein complex	IBA
GO:0071144	Component	Heteromeric SMAD protein complex	IDA	21828274
GO:0071144	Component	Heteromeric SMAD protein complex	IPI	15350224
GO:0071144	Component	Heteromeric SMAD protein complex	NAS	16322555
GO:0071559	Process	Response to transforming growth factor beta	IEA
GO:0071895	Process	Odontoblast differentiation	IEA
GO:0071895	Process	Odontoblast differentiation	ISS
GO:0097718	Function	Disordered domain specific binding	IPI	15231848
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	9702198, 11160896

MIM	HGNC	e!Ensembl
601366	6768	ENSG00000175387

Q15796

Protein name

Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2)

Protein function

Receptor-regulated SMAD (R-SMAD) that is an intracellular signal transducer and transcriptional modulator activated by TGF-beta (transforming growth factor) and activin type 1 receptor kinases. Binds the TRE element in the promoter region of man

PDB

1DEV , 1KHX , 1U7V , 2LB3 , 5XOD , 5ZOJ , 6M64 , 6YIA , 6ZVQ , 7CO1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03165	MH1	41 → 171	MH1 domain	Domain
PF03166	MH2	272 → 443	MH2 domain	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed at high levels in skeletal muscle, endothelial cells, heart and placenta. {ECO:0000269|PubMed:21599657}.

Sequence

MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS

Sequence length

467

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (5)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Congenital heart defects, multiple types, 8, with or without heterotaxy	Pathogenic	rs1402819968, rs367537998, rs797044882, rs2511349735, rs1064793873, rs397509416	RCV001789799 RCV002292376 RCV001789764 RCV004560530 RCV001789776 RCV001789751 View all (1 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Loeys-Dietz syndrome 1	Likely pathogenic	rs2511351266	RCV002288454	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Loeys-Dietz syndrome 6	Pathogenic; Likely pathogenic	rs2144276285, rs2144373131, rs2144300077, rs745853643, rs2511326359	RCV001789796 RCV001789800 RCV002249173 RCV002305874 RCV002471528	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
SMAD2-related cardiac disorders	Pathogenic	rs367537999	RCV003335853	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
SMAD2-related disorder	Likely pathogenic; Pathogenic	rs2144373131	RCV004552023	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (30)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL CONTRACTURAL ARACHNODACTYLY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DISEASE	—	ClinGen, Disgenet, Orphanet ClinGen, Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COPPER-OVERLOAD CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRANIOFACIAL ABNORMALITIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL ENAMEL HYPOPLASIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial thoracic aortic aneurysm and aortic dissection	Conflicting classifications of pathogenicity; Benign	ClinVar Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Gastric cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LOEYS-DIETZ SYNDROME	—	Disgenet, GenCC, Orphanet Disgenet, GenCC, Orphanet Disgenet, GenCC, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LOEYS-DIETZ SYNDROME, TYPE 1A	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYNCH SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MARFAN SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMAD2-congenital heart disease and multiple congenital anomaly disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOOTH AGENESIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR REMODELING	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (318)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acromicric Dysplasia	Acromicric Dysplasia	CTD_human_DG	18677313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acromicric dysplasia	Acromesomelic dysplasia	Pubtator	18677313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	28099259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11572763, 14647445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29490279, 30031128, 30365047, 30988629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of rectum	Adenocarcinoma Of Rectum	BEFREE	30637920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	24334458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	20495338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	26318657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	20460105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	23825360, 34185228	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	21624123, 27671303, 29956804, 31199988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	20829218, 28283438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic aneurysm	Pubtator	23291965	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	20829218, 23825360, 27394642	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	16556868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	Pubtator	16556868	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	31366242	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	20628268, 33362761	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	12170265		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	23093652, 28245135, 30201514, 30472056		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	30158495, 33245228	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	20954112, 29295709, 31441592	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	18194448, 28011270, 29245016, 29671258, 31606204, 31623508		★★★★★ ★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	30868685		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30655812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	30154949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	20829218, 27394642	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	11400114, 26873485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	26160166	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	19201832	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11809701, 15218362, 15231662, 17295676, 20010874, 23494890, 24564400, 26160166, 26279296, 27641158, 27829223, 28161325, 28867761, 29510731, 29796175, 29849800 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19838175, 20086175, 23022998, 25658913, 26160166, 27829223, 28272713, 28867761, 30343527, 33296812, 34297787, 38220208	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20562526	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	29453410	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16478646, 24696849, 31831717, 33954190, 36072623, 37079240	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10073143, 11215281, 21933118, 24715303, 9665198, 9892110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	10490821, 25342595, 26057631, 26290635, 27236156, 27292026, 28192402, 33399102, 33684566, 34184075, 34257565, 34281492	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26873485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25477335, 26581907, 27188428, 28370334, 30621196, 9503010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	24394555, 26091707, 29751820	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	21624123, 32291413, 33782384, 36207615, 39682758	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27166254, 29138866, 36313180	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	15736400, 21170261, 36543302	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	22301403, 30128029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24394555, 26091707, 29751820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinomatosis of peritoneal cavity	Peritoneal Carcinomatosis	BEFREE	22139024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	36936778	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	36878974	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Restrictive	Restrictive cardiomyopathy	Pubtator	35185369	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	30371322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	40028843	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal tunnel syndrome	Pubtator	30927912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage-hair hypoplasia	Cartilage-Hair Hypoplasia	BEFREE	30718282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cat eye syndrome	Cat Eye Syndrome	BEFREE	29089751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	34751414	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	29415065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy, Hereditary	Cerebral Amyloid Angiopathy	BEFREE	30868685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral hemorrhage with amyloidosis, hereditary, Dutch type	Cerebral Amyloid Angiopathy	BEFREE	28557134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29396549		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	12894231, 18425078		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	12894231, 18425078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	23687300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	29569474, 36443822	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	23088614, 23415961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choroid Plexus Carcinoma	Choroid Plexus Carcinoma	BEFREE	22554650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	10543255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30280598, 30587058, 31754396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28992620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	15318814, 24766819, 29456676, 30182733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	18949743	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	14520001, 21068203, 21747928, 28445620, 31383323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	28714374	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10438456, 10446110, 10665650, 11172591, 12584607, 12967141, 12973852, 18425078, 19531654, 23139211, 24627270, 25166914, 25736321, 25980495, 27330076 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10446110, 10781087, 11481457, 18219106, 18425817, 18959792, 20126641, 21068203, 21747928, 21978709, 22539990, 24427302, 24668684, 24696849, 28551381 View all (11 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18425078	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	26637634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	19188426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	19188426		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital heart disease	Congenital Heart Disease	GENOMICS_ENGLAND_DG	23665959		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	BEFREE	31317653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16969385, 20073064, 27166254, 31640193, 31729097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Copper-Overload Cirrhosis	Copper-Overload Cirrhosis	CTD_human_DG	22879914		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	29295709		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	29295709	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	29250160, 30157302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	19463161	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	29415065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	29967250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	31968593	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyclocephaly	Cyclocephaly	BEFREE	10835638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	25134464	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	17604656, 19583961, 28542404, 29257223, 29749497, 29925506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	22079283	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis Atopic	Atopic dermatitis	Pubtator	23436698, 29498756	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	12615364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Desmoid disease hereditary	Desmoid tumor	Pubtator	23035734	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	24595557, 30510624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	24595557, 27105518, 30510624, 31773714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	35841007	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28805484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	29138820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28805484, 29209813, 31701691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	30787994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Double Outlet Right Ventricle	Double outlet right ventricle	Pubtator	23899608	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	24047375	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren contracture	Pubtator	30927912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	BEFREE	28334068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	28987239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	29443735	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	15385128, 22072501, 26384307, 26963853, 29268772, 30431090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	21771027, 26384307, 29268772, 30276219, 30695033, 36659830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	29136085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	25207642, 30276219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	30276219, 31903498, 32348176	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	19796194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	28832026	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	24394555, 26091707, 29751820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	15736400, 30280774, 9197523	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	18496036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial thoracic aortic aneurysm and aortic dissection	Thoracic Aortic Aneurysm And Aortic Dissection	CLINGEN_DG	11779503, 18548003, 19224541, 26247899, 8980228, 9311995		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Familial thoracic aortic aneurysm and aortic dissection	Thoracic Aortic Aneurysm And Aortic Dissection	GENOMICS_ENGLAND_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Fibroid Tumor	Leiomyoma	BEFREE	19416222, 19700613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	23297089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	25351340, 26802603, 28153731, 28423499, 29128362, 29743985, 29966662, 30019838, 30119204, 30787972, 30900390, 31678285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	22539990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Geleophysic dysplasia	Geleophysic Dysplasia	BEFREE	18677313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Geleophysic dysplasia	Geleophysic Dysplasia	CTD_human_DG	18677313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	18711401, 21406405, 25275602, 25832460, 25994230, 31114250, 31603255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24759784, 25165192, 25832460, 26150340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	18711401, 21406405, 25275602, 25832460, 25994230, 26150340, 27527869, 30867843, 31114250, 31603255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	17292826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25165192, 30320350, 36181980, 36255058	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	26733179, 29145888, 29861845, 29955125, 31603255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	14531804	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	29415065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	23665959, 32341405, 40028843	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	36878974	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Septal Defects Ventricular	Congenital heart septal defect	Pubtator	23899608	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	23599148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	23599148	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	9436926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	10340381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Holoprosencephaly	Holoprosencephaly	BEFREE	17158784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	36976645	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	36976645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29654303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29196166, 30430898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	33125098	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19951945, 27909731	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	26809239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	20685750, 25476248, 26276873, 29952219, 30709904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	25476248, 30709904, 36012303, 36216496	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	14638911		★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	12063393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35840955	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	29415065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	40028843	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	29569474, 30182496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	28435089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	21310385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	25247416	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	17125594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	31754396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	31754396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	29443735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning disorders	Pubtator	32341405	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	19700613	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	19066393	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	26099922, 9436926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	33073700	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Linear Scleroderma	Linear Scleroderma	BEFREE	30367460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10490821, 10728705, 11170302, 11400114, 12700238, 12700666, 15188178, 22539990, 25826092, 26057631, 27292026, 28415588, 28454396, 28649002, 28903735 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17729405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	37446633	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	28734833, 29312546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Loeys-Dietz Syndrome	Loeys-Dietz Syndrome	BEFREE	29350460, 29392890, 30614814		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Loeys-Dietz Syndrome	Loeys-Dietz Syndrome	GENOMICS_ENGLAND_DG	29392890		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases	Lung disease	Pubtator	18219106	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	22659883, 25476248	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	25893292, 9328171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	30621196, 30942452, 36508813	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	36075396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	19937272	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	35456495, 35650563	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	9436926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	34569899	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	21106222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11809701, 15218362, 15231662, 20010874, 23494890, 24564400, 26160166, 26279296, 27641158, 27829223, 28161325, 28867761, 29510731, 29796175, 29849800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	15385128, 26963853, 30431090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	18691855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	17546056, 31387321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29545874, 30301907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10073143, 10438456, 10822381, 18174241, 25477335, 26581907, 27188428, 28370334, 30621196, 9466656, 9503010, 9635866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	12649207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	27840954, 30838724, 31199988, 8752209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10420150, 11402322, 28116672, 29039572, 29278879, 31846689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	18618014, 22301403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	10073143, 11572763, 22539990, 23934187, 26212015, 26983401, 27383203, 29348665, 30802150, 31469179, 31773690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26873485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11170302, 11400114, 11572763, 12618756, 12821112, 12894231, 14678987, 15231662, 18691855, 20080647, 21441952, 22301403, 22452939, 22539990, 23866946 View all (21 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	12894231, 18425078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	14520001, 21068203, 21747928, 28445620, 31383323, 9635866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11809701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15218362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	20829218, 23291965, 29174139	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Marfan Syndrome	Marfan Syndrome	BEFREE	29350460, 31272746, 31284709		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	11278410, 21477078, 33202380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	26526369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	35131256	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	11304690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	25557874	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	29051557	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29051557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	32928102	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis III	Mucopolysaccharidosis	Pubtator	25373709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple congenital anomalies	Multiple Congenital Anomalies	CLINVAR_DG	10068469, 11024047, 23665959, 26247899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	19201832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	19201832	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	39985494	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	32359374	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	9665198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	17637430, 25789971, 30050588, 30317569, 31085202, 31623508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	28779150, 30015862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	28779150, 36976645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	20416076, 35266323	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28356956, 29710466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	24129565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10073143, 10420150, 10438456, 10490821, 10543255, 10665650, 10781087, 10789724, 11196469, 11304690, 11391794, 11400114, 11410498, 11809701, 12700238 View all (44 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	31035970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	17214327	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	21046120, 27756784, 9288786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	18174241, 24698130, 27735039, 28375158, 28440452, 29123964, 30365047, 31344049, 31762811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28987239, 30030373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	30920079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	23284772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	32102517, 37755664	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	32319543, 34608249, 37652257	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29457300, 30834706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	29532880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	29532880, 30834706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	22868198, 29115549, 29731864, 29949655, 30243739, 31059706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	22868198	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24394555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11438451, 24394555, 30448260, 35053353, 36072623	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	27840954, 30838724, 31199988, 8752209, 9892110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	21624123, 26908446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	26279302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	27840954, 30838724, 33782384, 36207615, 37086509, 38058074	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	28099259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	31485676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	19016724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	29737911	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	22139024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	33508890	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peutz-Jeghers Syndrome	Peutz-Jeghers Syndrome	BEFREE	11215281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peyronie Disease	Peyronie Disease	BEFREE	23770939, 31496148		★★★★★ ★☆☆☆☆ Found in Text Mining only
PNEUMOTHORAX, PRIMARY SPONTANEOUS	Pneumothorax	BEFREE	29707331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	19259356, 22174924	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	20549648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	24911914, 30536903, 31049834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	31821687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	15566516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10420150, 11402322, 28116672, 29039572, 29278879, 31846689		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Diseases	Prostatic Diseases	BEFREE	28116672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	28116672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17579118, 29164579, 30209539, 36999196, 39786309	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	19688145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	18496036, 30274147	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23315259, 26370615, 26600197, 28244647, 29666896, 29805609, 29952219, 30021376, 30869194, 31215034, 31358001, 31775746, 31809714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	33149556, 37898439	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	21068203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16969385, 20073064, 31729097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	21927575, 26919280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	31240212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	16211216, 30401983, 31451106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	30401983, 32407730, 34969359	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	26445225	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	11904440, 26217927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	24578173, 37587067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30784922, 31174089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Shprintzen-Goldberg syndrome	Shprintzen-Goldberg Syndrome	BEFREE	23103230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Shwachman syndrome	Shwachman Syndrome	BEFREE	19016724, 31039138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	18618014, 24954139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	16478646, 17217620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	18618014, 20462450, 20852387, 21170261, 22301403, 31694906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	10995883, 18691855, 26674378, 9197523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	16478646, 17217620, 20462450, 29443735, 29879932, 30914776, 31257489, 32928102, 33593111	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	30914776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	29581863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	11410498, 16478646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22539990, 23934187, 26212015, 26983401, 27383203, 29348665, 30802150, 31469179, 31773690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	21110833, 22539990, 23873106, 27383203, 28165563, 31773690, 33508890, 34138687, 34686196, 35458126, 37415735	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23285052	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	38181310	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	11904440, 16319104, 22890162, 26217927, 29805609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophlebitis	Thrombophlebitis	Pubtator	21478096	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	28039715	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	32138807	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	18383837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24197660, 28038450, 30012564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34326372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	30653987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	31677482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	26152796, 26873485, 26988652, 29349903, 31238579, 35048477	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neurogenic	Neurogenic bladder	Pubtator	35662268	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cancer	Endometrial Cancer	BEFREE	30651315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Carcinosarcoma	Endometrial Cancer	BEFREE	22072501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	BEFREE	12894231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	18425078, 25988335, 31663517, 33098235, 33954190	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	32348176	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	19416222, 19700613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	21478096	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	21478096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	17662915, 29046343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	23899608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	31035970	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SMAD2 (SMAD family member 2)