Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	245937
Gene name	Defensin beta 124
Gene symbol	DEFB124
Synonyms (NCBI Gene)	DEFB-24
Chromosome	20
Chromosome location	20q11.21
Summary	Defensins are cysteine-rich cationic polypeptides that are important in the host immunologic response to invading microorganisms. This antimicrobial protein is secreted and is a member of the beta defensin protein family. Beta defensin genes are found in

14 Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0006952	Process	Defense response	IEA
GO:0007249	Process	Canonical NF-kappaB signal transduction	IDA	24955228
GO:0032722	Process	Positive regulation of chemokine production	IDA	24955228
GO:0032735	Process	Positive regulation of interleukin-12 production	IDA	24955228
GO:0032743	Process	Positive regulation of interleukin-2 production	IDA	24955228
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	24955228
GO:0042742	Process	Defense response to bacterium	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0071224	Process	Cellular response to peptidoglycan	IDA	24955228
GO:0071651	Process	Positive regulation of chemokine (C-C motif) ligand 5 production	IDA	24955228
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IDA	24955228
GO:2000343	Process	Positive regulation of chemokine (C-X-C motif) ligand 2 production	IDA	24955228

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Protein name

Beta-defensin 124 (Beta-defensin 24) (DEFB-24) (Defensin, beta 124)

Protein function

Has antibacterial activity.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13841	Defensin_beta_2	26 → 55	Beta defensin	Domain

Sequence

MTQLLLFLVALLVLGHVPSGRSEFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYAL
KPPPVPKHEYE

Sequence length

Interactions

View interactions

Reactome Pathway
Beta defensins
Defensins

DEFB124 (defensin beta 124)