DEFB130B (defensin beta 130B)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100133267
Gene name Defensin beta 130B
Gene symbol DEFB130B
Synonyms (NCBI Gene)
-
Chromosome 8
Chromosome location 8p23.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
GO:0006952 Process Defense response IEA
GO:0031731 Function CCR6 chemokine receptor binding IBA
GO:0042056 Function Chemoattractant activity IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0DP73
Protein name Beta-defensin 130B
Protein function Antimicrobial host-defense peptide. Has an antiplasmodial activity.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00711 Defensin_beta 28 → 61 Beta defensin Domain
Tissue specificity TISSUE SPECIFICITY: Expressed on differentiated macrophage phagocytizing plasmodium falciparum-parasitized erythrocytes. {ECO:0000269|PubMed:28181499}.
Sequence 
MKLHSLISVLLLFVTLIPKGKTGVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCC
RRWWILEPYPTPVPKGKSP
Sequence length 79
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Beta defensins
Defensins
Sort by:
DEFB118 2 shared pathwaysBeta defensins, Defensins Related via 2 shared pathways including Beta defensins, Defensins. DEFB104A 2 shared pathwaysBeta defensins, Defensins Related via 2 shared pathways including Beta defensins, Defensins. DEFB127 2 shared pathwaysBeta defensins, Defensins Related via 2 shared pathways including Beta defensins, Defensins. DEFB129 2 shared pathwaysBeta defensins, Defensins Related via 2 shared pathways including Beta defensins, Defensins. DEFB105A 2 shared pathwaysBeta defensins, Defensins Related via 2 shared pathways including Beta defensins, Defensins.
Insomnia Linked via 1 of 5 related genesDEFB118 Coronary artery disease Linked via 1 of 5 related genesDEFB127 Obesity Linked via 1 of 5 related genesDEFB127 Obstructive sleep apnea syndrome Linked via 1 of 5 related genesDEFB127 Hirschsprung disease Linked via 1 of 5 related genesDEFB129