Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	245928
Gene name	Defensin beta 114
Gene symbol	DEFB114
Synonyms (NCBI Gene)	DEFB-14DEFB14
Chromosome	6
Chromosome location	6p12.3
Summary	Defensins form a family of antimicrobial and cytotoxic peptides made by neutrophils. Defensins are short, processed peptide molecules that are classified by structure into three groups: alpha-defensins, beta-defensins and theta-defensins. All beta-defensi

19 Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001530	Function	Lipopolysaccharide binding	IDA	23482568
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0006952	Process	Defense response	IEA
GO:0031665	Process	Negative regulation of lipopolysaccharide-mediated signaling pathway	IDA	23482568
GO:0031731	Function	CCR6 chemokine receptor binding	IBA
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IMP	23482568
GO:0042056	Function	Chemoattractant activity	IBA
GO:0042742	Process	Defense response to bacterium	IBA
GO:0042742	Process	Defense response to bacterium	IEA
GO:0043407	Process	Negative regulation of MAP kinase activity	IMP	23482568
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	IMP	23482568
GO:0050729	Process	Positive regulation of inflammatory response	IMP	23482568
GO:0050829	Process	Defense response to Gram-negative bacterium	IMP	23482568
GO:0050830	Process	Defense response to Gram-positive bacterium	IMP	23482568
GO:0050918	Process	Positive chemotaxis	IEA
GO:0060326	Process	Cell chemotaxis	IBA
GO:0061760	Process	Antifungal innate immune response	IMP	23482568

MIM	HGNC	e!Ensembl
615243	18095	ENSG00000177684

Q30KQ6

Protein name

Beta-defensin 114 (Beta-defensin 14) (DEFB-14) (Defensin, beta 114)

Protein function

Has a salt-sensitive antimicrobial activity against Gram-negative bacteria, including E.coli, Gram-positive, including S.aureus, and fungi, including C.albicans. Binds to and neutralizes bacterial lipopolysaccharides (LPS), abolishing TNF produc

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13841	Defensin_beta_2	28 → 58	Beta defensin	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in epididymis, predominantly in the caput (at protein level). {ECO:0000269|PubMed:23482568}.

Sequence

MRIFYYLHFLCYVTFILPATCTLVNADRCTKRYGRCKRDCLESEKQIDICSLPRKICCTE
KLYEEDDMF

Sequence length

Interactions

View interactions

Reactome Pathway
Beta defensins
Defensins

DEFB114 (defensin beta 114)

Bookmark This Gene