DEFB113 (defensin beta 113)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 245927
Gene name Defensin beta 113
Gene symbol DEFB113
Synonyms (NCBI Gene)
DEFB-13
Chromosome 6
Chromosome location 6p12.3
Summary Defensins form a family of antimicrobial and cytotoxic peptides made by neutrophils. Defensins are short, processed peptide molecules that are classified by structure into three groups: alpha-defensins, beta-defensins and theta-defensins. All beta-defensi
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0006952 Process Defense response IEA
GO:0042742 Process Defense response to bacterium IEA
GO:0045087 Process Innate immune response IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q30KQ7
Protein name Beta-defensin 113 (Beta-defensin 13) (DEFB-13) (Defensin, beta 113)
Protein function Has antibacterial activity.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13841 Defensin_beta_2 34 → 62 Beta defensin Domain
Sequence 
MKILCIFLTFVFTVSCGPSVPQKKTREVAERKRECQLVRGACKPECNSWEYVYYYCNVNP
CCAVWEYQKPIINKITSKLHQK
Sequence length 82
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Beta defensins
Defensins
Sort by:
DEFB130B 2 shared pathwaysBeta defensins, Defensins Related via 2 shared pathways including Beta defensins, Defensins. DEFB118 2 shared pathwaysBeta defensins, Defensins Related via 2 shared pathways including Beta defensins, Defensins. DEFB104A 2 shared pathwaysBeta defensins, Defensins Related via 2 shared pathways including Beta defensins, Defensins. DEFB127 2 shared pathwaysBeta defensins, Defensins Related via 2 shared pathways including Beta defensins, Defensins. DEFB129 2 shared pathwaysBeta defensins, Defensins Related via 2 shared pathways including Beta defensins, Defensins.
Insomnia Linked via 1 of 5 related genesDEFB118 Coronary artery disease Linked via 1 of 5 related genesDEFB127 Obesity Linked via 1 of 5 related genesDEFB127 Obstructive sleep apnea syndrome Linked via 1 of 5 related genesDEFB127 Hirschsprung disease Linked via 1 of 5 related genesDEFB129