Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	11258
Gene name	Dynactin subunit 3
Gene symbol	DCTN3
Synonyms (NCBI Gene)	DCTN-22DCTN22
Chromosome	9
Chromosome location	9p13.3
Summary	This gene encodes the smallest subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions,

151 Show/Hide all (151)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022659	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT029403	hsa-miR-26b-5p	Microarray	19088304
MIRT041712	hsa-miR-484	CLASH	23622248
MIRT037021	hsa-miR-877-3p	CLASH	23622248
MIRT690614	hsa-miR-548c-3p	HITS-CLIP	23313552
MIRT690613	hsa-miR-6858-3p	HITS-CLIP	23313552
MIRT690612	hsa-miR-4676-5p	HITS-CLIP	23313552
MIRT690611	hsa-miR-575	HITS-CLIP	23313552
MIRT690610	hsa-miR-3934-5p	HITS-CLIP	23313552
MIRT690609	hsa-miR-340-3p	HITS-CLIP	23313552
MIRT690608	hsa-miR-6827-3p	HITS-CLIP	23313552
MIRT690607	hsa-miR-4684-5p	HITS-CLIP	23313552
MIRT037021	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT659171	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT659170	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT659169	hsa-miR-1287-3p	HITS-CLIP	23824327
MIRT659168	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT659167	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT638810	hsa-miR-4714-5p	HITS-CLIP	23824327
MIRT638809	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT638808	hsa-miR-3921	HITS-CLIP	23824327
MIRT638807	hsa-miR-4653-5p	HITS-CLIP	23824327
MIRT638806	hsa-miR-4251	HITS-CLIP	23824327
MIRT638805	hsa-miR-4329	HITS-CLIP	23824327
MIRT638804	hsa-miR-6761-5p	HITS-CLIP	23824327
MIRT638803	hsa-miR-6089	HITS-CLIP	23824327
MIRT638802	hsa-miR-7977	HITS-CLIP	23824327
MIRT638810	hsa-miR-4714-5p	HITS-CLIP	23824327
MIRT638809	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT638808	hsa-miR-3921	HITS-CLIP	23824327
MIRT638807	hsa-miR-4653-5p	HITS-CLIP	23824327
MIRT638806	hsa-miR-4251	HITS-CLIP	23824327
MIRT638805	hsa-miR-4329	HITS-CLIP	23824327
MIRT638804	hsa-miR-6761-5p	HITS-CLIP	23824327
MIRT638803	hsa-miR-6089	HITS-CLIP	23824327
MIRT638802	hsa-miR-7977	HITS-CLIP	23824327
MIRT690614	hsa-miR-548c-3p	HITS-CLIP	23313552
MIRT690613	hsa-miR-6858-3p	HITS-CLIP	23313552
MIRT690612	hsa-miR-4676-5p	HITS-CLIP	23313552
MIRT690611	hsa-miR-575	HITS-CLIP	23313552
MIRT690610	hsa-miR-3934-5p	HITS-CLIP	23313552
MIRT690609	hsa-miR-340-3p	HITS-CLIP	23313552
MIRT690608	hsa-miR-6827-3p	HITS-CLIP	23313552
MIRT690607	hsa-miR-4684-5p	HITS-CLIP	23313552
MIRT037021	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT659171	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT659170	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT659169	hsa-miR-1287-3p	HITS-CLIP	23824327
MIRT659168	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT659167	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT638810	hsa-miR-4714-5p	HITS-CLIP	23824327
MIRT638809	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT638808	hsa-miR-3921	HITS-CLIP	23824327
MIRT638807	hsa-miR-4653-5p	HITS-CLIP	23824327
MIRT638806	hsa-miR-4251	HITS-CLIP	23824327
MIRT638805	hsa-miR-4329	HITS-CLIP	23824327
MIRT638804	hsa-miR-6761-5p	HITS-CLIP	23824327
MIRT638803	hsa-miR-6089	HITS-CLIP	23824327
MIRT638802	hsa-miR-7977	HITS-CLIP	23824327
MIRT638810	hsa-miR-4714-5p	HITS-CLIP	23824327
MIRT638809	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT638808	hsa-miR-3921	HITS-CLIP	23824327
MIRT638807	hsa-miR-4653-5p	HITS-CLIP	23824327
MIRT638806	hsa-miR-4251	HITS-CLIP	23824327
MIRT638805	hsa-miR-4329	HITS-CLIP	23824327
MIRT638804	hsa-miR-6761-5p	HITS-CLIP	23824327
MIRT638803	hsa-miR-6089	HITS-CLIP	23824327
MIRT638802	hsa-miR-7977	HITS-CLIP	23824327
MIRT927183	hsa-miR-1275	CLIP-seq
MIRT927184	hsa-miR-141	CLIP-seq
MIRT927185	hsa-miR-200a	CLIP-seq
MIRT927186	hsa-miR-299-5p	CLIP-seq
MIRT927187	hsa-miR-3675-3p	CLIP-seq
MIRT927188	hsa-miR-4420	CLIP-seq
MIRT927189	hsa-miR-4511	CLIP-seq
MIRT927190	hsa-miR-4665-5p	CLIP-seq
MIRT927191	hsa-miR-4723-5p	CLIP-seq
MIRT927192	hsa-miR-4728-5p	CLIP-seq
MIRT927193	hsa-miR-509-3p	CLIP-seq
MIRT927194	hsa-miR-548b-3p	CLIP-seq
MIRT927195	hsa-miR-584	CLIP-seq
MIRT927196	hsa-miR-668	CLIP-seq
MIRT927183	hsa-miR-1275	CLIP-seq
MIRT927184	hsa-miR-141	CLIP-seq
MIRT927185	hsa-miR-200a	CLIP-seq
MIRT1547879	hsa-miR-4455	CLIP-seq
MIRT927189	hsa-miR-4511	CLIP-seq
MIRT927190	hsa-miR-4665-5p	CLIP-seq
MIRT1547880	hsa-miR-4684-3p	CLIP-seq
MIRT927191	hsa-miR-4723-5p	CLIP-seq
MIRT927192	hsa-miR-4728-5p	CLIP-seq
MIRT927193	hsa-miR-509-3p	CLIP-seq
MIRT1547881	hsa-miR-518a-5p	CLIP-seq
MIRT1547882	hsa-miR-527	CLIP-seq
MIRT927194	hsa-miR-548b-3p	CLIP-seq
MIRT1547883	hsa-miR-609	CLIP-seq
MIRT927183	hsa-miR-1275	CLIP-seq
MIRT927184	hsa-miR-141	CLIP-seq
MIRT927185	hsa-miR-200a	CLIP-seq
MIRT927186	hsa-miR-299-5p	CLIP-seq
MIRT927188	hsa-miR-4420	CLIP-seq
MIRT1547879	hsa-miR-4455	CLIP-seq
MIRT927189	hsa-miR-4511	CLIP-seq
MIRT927190	hsa-miR-4665-5p	CLIP-seq
MIRT1547880	hsa-miR-4684-3p	CLIP-seq
MIRT927191	hsa-miR-4723-5p	CLIP-seq
MIRT927192	hsa-miR-4728-5p	CLIP-seq
MIRT927193	hsa-miR-509-3p	CLIP-seq
MIRT1547881	hsa-miR-518a-5p	CLIP-seq
MIRT1547882	hsa-miR-527	CLIP-seq
MIRT927194	hsa-miR-548b-3p	CLIP-seq
MIRT927195	hsa-miR-584	CLIP-seq
MIRT1547883	hsa-miR-609	CLIP-seq
MIRT927196	hsa-miR-668	CLIP-seq
MIRT927183	hsa-miR-1275	CLIP-seq
MIRT2210024	hsa-miR-127-5p	CLIP-seq
MIRT2210025	hsa-miR-1303	CLIP-seq
MIRT927184	hsa-miR-141	CLIP-seq
MIRT927185	hsa-miR-200a	CLIP-seq
MIRT2210026	hsa-miR-2861	CLIP-seq
MIRT927186	hsa-miR-299-5p	CLIP-seq
MIRT927187	hsa-miR-3675-3p	CLIP-seq
MIRT927188	hsa-miR-4420	CLIP-seq
MIRT1547879	hsa-miR-4455	CLIP-seq
MIRT927189	hsa-miR-4511	CLIP-seq
MIRT2210027	hsa-miR-4635	CLIP-seq
MIRT927190	hsa-miR-4665-5p	CLIP-seq
MIRT1547880	hsa-miR-4684-3p	CLIP-seq
MIRT927191	hsa-miR-4723-5p	CLIP-seq
MIRT927192	hsa-miR-4728-5p	CLIP-seq
MIRT2210028	hsa-miR-4786-3p	CLIP-seq
MIRT2210029	hsa-miR-4797-5p	CLIP-seq
MIRT2210030	hsa-miR-490-3p	CLIP-seq
MIRT927193	hsa-miR-509-3p	CLIP-seq
MIRT1547881	hsa-miR-518a-5p	CLIP-seq
MIRT1547882	hsa-miR-527	CLIP-seq
MIRT2210031	hsa-miR-541	CLIP-seq
MIRT927194	hsa-miR-548b-3p	CLIP-seq
MIRT927195	hsa-miR-584	CLIP-seq
MIRT1547883	hsa-miR-609	CLIP-seq
MIRT2210032	hsa-miR-649	CLIP-seq
MIRT2210033	hsa-miR-654-5p	CLIP-seq
MIRT927196	hsa-miR-668	CLIP-seq
MIRT927184	hsa-miR-141	CLIP-seq
MIRT927185	hsa-miR-200a	CLIP-seq
MIRT927186	hsa-miR-299-5p	CLIP-seq
MIRT927188	hsa-miR-4420	CLIP-seq
MIRT927189	hsa-miR-4511	CLIP-seq
MIRT927193	hsa-miR-509-3p	CLIP-seq
MIRT927194	hsa-miR-548b-3p	CLIP-seq
MIRT927196	hsa-miR-668	CLIP-seq

27 Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000278	Process	Mitotic cell cycle	TAS	9722614
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IEA
GO:0005198	Function	Structural molecule activity	TAS	9722614
GO:0005515	Function	Protein binding	IPI	9722614, 32296183, 32814053
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	21399614
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005869	Component	Dynactin complex	IBA
GO:0005869	Component	Dynactin complex	IEA
GO:0005869	Component	Dynactin complex	IPI	9722614
GO:0005869	Component	Dynactin complex	TAS	9722614
GO:0005875	Component	Microtubule associated complex	IEA
GO:0007017	Process	Microtubule-based process	IEA
GO:0030496	Component	Midbody	IEA
GO:0032154	Component	Cleavage furrow	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	9722614
GO:0051301	Process	Cell division	IEA
GO:0061640	Process	Cytoskeleton-dependent cytokinesis	IBA
GO:0061640	Process	Cytoskeleton-dependent cytokinesis	IDA	9722614
GO:0061640	Process	Cytoskeleton-dependent cytokinesis	IEA

MIM	HGNC	e!Ensembl
607387	2713	ENSG00000137100

O75935

Protein name

Dynactin subunit 3 (Dynactin complex subunit 22 kDa subunit) (p22)

Protein function

Part of the dynactin complex that activates the molecular motor dynein for ultra-processive transport along microtubules (By similarity). Together with dynein may be involved in spindle assembly and cytokinesis (PubMed:9722614). {ECO:0000250|Uni

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07426	Dynactin_p22	6 → 170	Dynactin subunit p22	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. Highly expressed in muscle and pancreas and detected at lower levels in brain. {ECO:0000269|PubMed:9722614}.

Sequence

MAGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSKRERVKILYKK
IEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVP
EHAARLQRLAQIHIQQQDQCVEITEESKALLEEYNKTTMLLSKQFVQWDELLCQLEAATQ
VKPAEE

Sequence length

186

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Motor proteins	MHC class II antigen presentation
Amyotrophic lateral sclerosis	Regulation of PLK1 Activity at G2/M Transition
Huntington disease	HSP90 chaperone cycle for steroid hormone receptors (SHR)
Pathways of neurodegeneration - multiple diseases	Loss of Nlp from mitotic centrosomes
Salmonella infection	Recruitment of mitotic centrosome proteins and complexes
	Loss of proteins required for interphase microtubule organization from the centrosome
	Recruitment of NuMA to mitotic centrosomes
	Anchoring of the basal body to the plasma membrane
	COPI-mediated anterograde transport
	COPI-independent Golgi-to-ER retrograde traffic
	AURKA Activation by TPX2

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BULLOUS PEMPHIGOID	—	GWAS catalog	37156394	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (26)
Arthritis	Arthritis	BEFREE	8027338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	3864386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17855657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17855657	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	11960291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilaginous exostosis	Osteochondroma	BEFREE	12505252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	28356734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibromuscular Dysplasia	Fibromuscular Dysplasia	BEFREE	24352458		★★★★★ ★☆☆☆☆ Found in Text Mining only
FRONTOMETAPHYSEAL DYSPLASIA 1	Frontometaphyseal Dysplasia	BEFREE	24352458		★★★★★ ★☆☆☆☆ Found in Text Mining only
GLOMUVENOUS MALFORMATIONS	Glomuvenous Malformation	BEFREE	17680968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning Disorders	BEFREE	9674899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	25060540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24847525, 31019054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	8501979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24847525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	7438112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	25060540	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	BEFREE	24352458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11960291, 15949565, 17656251, 6197160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	29463260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	3496149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	30042193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17712417	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	3864386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	21902598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	17656251		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
ACTR1A	[]	13	["Motor proteins","Salmonella infection","COPI-mediated anterograde transport","MHC class II antigen presentation","Regulation of PLK1 Activity at G2\/M Transition","HSP90 chaperone cycle for steroid hormone receptors (SHR)","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","COPI-independent Golgi-to-ER retrograde traffic"]	[]
DCTN2	[]	13	["Motor proteins","Salmonella infection","COPI-mediated anterograde transport","MHC class II antigen presentation","Regulation of PLK1 Activity at G2\/M Transition","HSP90 chaperone cycle for steroid hormone receptors (SHR)","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","COPI-independent Golgi-to-ER retrograde traffic"]	[]
DCTN1	[]	13	["Motor proteins","Salmonella infection","COPI-mediated anterograde transport","MHC class II antigen presentation","Regulation of PLK1 Activity at G2\/M Transition","HSP90 chaperone cycle for steroid hormone receptors (SHR)","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","COPI-independent Golgi-to-ER retrograde traffic"]	[]
TUBG1	[]	8	["Motor proteins","Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	[]
DYNC1H1	[]	13	["Motor proteins","Salmonella infection","COPI-mediated anterograde transport","MHC class II antigen presentation","Regulation of PLK1 Activity at G2\/M Transition","HSP90 chaperone cycle for steroid hormone receptors (SHR)","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","COPI-independent Golgi-to-ER retrograde traffic"]	[]

DCTN3 (dynactin subunit 3)

Save This Analysis