Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	10540
Gene name	Dynactin subunit 2
Gene symbol	DCTN2
Synonyms (NCBI Gene)	DCTN50DYNAMITINHEL-S-77RBP50
Chromosome	12
Chromosome location	12q13.3
Summary	This gene encodes a 50-kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, in

91 Show/Hide all (91)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050704	hsa-miR-18a-5p	CLASH	23622248
MIRT045677	hsa-miR-149-5p	CLASH	23622248
MIRT037985	hsa-miR-502-3p	CLASH	23622248
MIRT927159	hsa-miR-1275	CLIP-seq
MIRT927160	hsa-miR-2355-5p	CLIP-seq
MIRT927161	hsa-miR-27a	CLIP-seq
MIRT927162	hsa-miR-27b	CLIP-seq
MIRT927163	hsa-miR-3147	CLIP-seq
MIRT927164	hsa-miR-320e	CLIP-seq
MIRT927165	hsa-miR-330-3p	CLIP-seq
MIRT927166	hsa-miR-3667-3p	CLIP-seq
MIRT927167	hsa-miR-3667-5p	CLIP-seq
MIRT927168	hsa-miR-4286	CLIP-seq
MIRT927169	hsa-miR-4425	CLIP-seq
MIRT927170	hsa-miR-4525	CLIP-seq
MIRT927171	hsa-miR-4645-5p	CLIP-seq
MIRT927172	hsa-miR-4665-5p	CLIP-seq
MIRT927173	hsa-miR-4673	CLIP-seq
MIRT927174	hsa-miR-4691-3p	CLIP-seq
MIRT927175	hsa-miR-4723-5p	CLIP-seq
MIRT927176	hsa-miR-4728-5p	CLIP-seq
MIRT927177	hsa-miR-4733-3p	CLIP-seq
MIRT927178	hsa-miR-4742-5p	CLIP-seq
MIRT927179	hsa-miR-4797-5p	CLIP-seq
MIRT927180	hsa-miR-500a	CLIP-seq
MIRT927181	hsa-miR-513a-5p	CLIP-seq
MIRT927182	hsa-miR-625	CLIP-seq
MIRT1974585	hsa-miR-296-5p	CLIP-seq
MIRT1974586	hsa-miR-3175	CLIP-seq
MIRT1974587	hsa-miR-3184	CLIP-seq
MIRT1974588	hsa-miR-361-3p	CLIP-seq
MIRT1974589	hsa-miR-3622b-5p	CLIP-seq
MIRT1974590	hsa-miR-3652	CLIP-seq
MIRT1974591	hsa-miR-423-5p	CLIP-seq
MIRT1974592	hsa-miR-4430	CLIP-seq
MIRT1974593	hsa-miR-4474-3p	CLIP-seq
MIRT1974594	hsa-miR-4505	CLIP-seq
MIRT1974595	hsa-miR-4642	CLIP-seq
MIRT1974596	hsa-miR-4650-5p	CLIP-seq
MIRT1974597	hsa-miR-4786-5p	CLIP-seq
MIRT1974598	hsa-miR-544b	CLIP-seq
MIRT1974599	hsa-miR-662	CLIP-seq
MIRT927159	hsa-miR-1275	CLIP-seq
MIRT2210016	hsa-miR-219-1-3p	CLIP-seq
MIRT927160	hsa-miR-2355-5p	CLIP-seq
MIRT927163	hsa-miR-3147	CLIP-seq
MIRT2210017	hsa-miR-3157-5p	CLIP-seq
MIRT927165	hsa-miR-330-3p	CLIP-seq
MIRT927166	hsa-miR-3667-3p	CLIP-seq
MIRT927167	hsa-miR-3667-5p	CLIP-seq
MIRT927168	hsa-miR-4286	CLIP-seq
MIRT927169	hsa-miR-4425	CLIP-seq
MIRT2210018	hsa-miR-4520a-3p	CLIP-seq
MIRT2210019	hsa-miR-4520b-3p	CLIP-seq
MIRT927170	hsa-miR-4525	CLIP-seq
MIRT927171	hsa-miR-4645-5p	CLIP-seq
MIRT927172	hsa-miR-4665-5p	CLIP-seq
MIRT927173	hsa-miR-4673	CLIP-seq
MIRT927174	hsa-miR-4691-3p	CLIP-seq
MIRT2210020	hsa-miR-4715-5p	CLIP-seq
MIRT927175	hsa-miR-4723-5p	CLIP-seq
MIRT927176	hsa-miR-4728-5p	CLIP-seq
MIRT927177	hsa-miR-4733-3p	CLIP-seq
MIRT927178	hsa-miR-4742-5p	CLIP-seq
MIRT927180	hsa-miR-500a	CLIP-seq
MIRT2210021	hsa-miR-571	CLIP-seq
MIRT2210022	hsa-miR-582-5p	CLIP-seq
MIRT927182	hsa-miR-625	CLIP-seq
MIRT2210023	hsa-miR-664	CLIP-seq
MIRT2513922	hsa-miR-1237	CLIP-seq
MIRT1974586	hsa-miR-3175	CLIP-seq
MIRT1974587	hsa-miR-3184	CLIP-seq
MIRT927165	hsa-miR-330-3p	CLIP-seq
MIRT1974588	hsa-miR-361-3p	CLIP-seq
MIRT2513923	hsa-miR-3664-5p	CLIP-seq
MIRT2513924	hsa-miR-3682-3p	CLIP-seq
MIRT1974591	hsa-miR-423-5p	CLIP-seq
MIRT2513925	hsa-miR-4502	CLIP-seq
MIRT2210018	hsa-miR-4520a-3p	CLIP-seq
MIRT2210019	hsa-miR-4520b-3p	CLIP-seq
MIRT927171	hsa-miR-4645-5p	CLIP-seq
MIRT1974596	hsa-miR-4650-5p	CLIP-seq
MIRT927173	hsa-miR-4673	CLIP-seq
MIRT927177	hsa-miR-4733-3p	CLIP-seq
MIRT2513926	hsa-miR-4742-3p	CLIP-seq
MIRT927178	hsa-miR-4742-5p	CLIP-seq
MIRT2513927	hsa-miR-4762-3p	CLIP-seq
MIRT1974597	hsa-miR-4786-5p	CLIP-seq
MIRT1974598	hsa-miR-544b	CLIP-seq
MIRT2513928	hsa-miR-630	CLIP-seq
MIRT2210023	hsa-miR-664	CLIP-seq

27 Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000776	Component	Kinetochore	IDA	8647893
GO:0005515	Function	Protein binding	IPI	10226031, 16189514, 17139249, 17500595, 20978158, 21988832, 22046132, 23414759, 25416956, 26638075, 26950892, 27107012, 31515488, 32296183, 32814053, 33961781
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	8647893, 21399614
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005869	Component	Dynactin complex	IBA
GO:0005869	Component	Dynactin complex	IDA	8647893
GO:0005869	Component	Dynactin complex	IEA
GO:0005874	Component	Microtubule	IEA
GO:0007017	Process	Microtubule-based process	IEA
GO:0007052	Process	Mitotic spindle organization	IBA
GO:0007052	Process	Mitotic spindle organization	IMP	8647893
GO:0007080	Process	Mitotic metaphase chromosome alignment	IMP	8647893
GO:0016020	Component	Membrane	IEA
GO:0019901	Function	Protein kinase binding	IPI	17139249
GO:0030286	Component	Dynein complex	IEA
GO:0030426	Component	Growth cone	IEA
GO:0030507	Function	Spectrin binding	IDA	23704327
GO:0031982	Component	Vesicle	IDA	20682791
GO:0032402	Process	Melanosome transport	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0071539	Process	Protein localization to centrosome	IMP	24816561

MIM	HGNC	e!Ensembl
607376	2712	ENSG00000175203

Q13561

Protein name

Dynactin subunit 2 (50 kDa dynein-associated polypeptide) (Dynactin complex 50 kDa subunit) (DCTN-50) (p50 dynamitin)

Protein function

Part of the dynactin complex that activates the molecular motor dynein for ultra-processive transport along microtubules. In the dynactin soulder domain, binds the ACTR1A filament and acts as a molecular ruler to determine the length (By similar

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04912	Dynamitin	16 → 399	Dynamitin	Family

Sequence

MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAEELTSTSVEHIIVNPNAAYDKFKDK
RVGTKGLDFSDRIGKTKRTGYESGEYEMLGEGLGVKETPQQKYQRLLHEVQELTTEVEKI
KTTVKESATEEKLTPVLLAKQLAALKQQLVASHLEKLLGPDAAINLTDPDGALAKRLLLQ
LEATKNSKGGSGGKTTGTPPDSSLVTYELHSRPEQDKFSQAAKVAELEKRLTELETAVRC
DQDAQNPLSAGLQGACLMETVELLQAKVSALDLAVLDQVEARLQSVLGKVNEIAKHKASV
EDADTQSKVHQLYETIQRWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMI
ANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKKLGK

Sequence length

401

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Motor proteins	MHC class II antigen presentation
Vasopressin-regulated water reabsorption	Regulation of PLK1 Activity at G2/M Transition
Amyotrophic lateral sclerosis	HSP90 chaperone cycle for steroid hormone receptors (SHR)
Huntington disease	Loss of Nlp from mitotic centrosomes
Pathways of neurodegeneration - multiple diseases	Recruitment of mitotic centrosome proteins and complexes
Salmonella infection	Loss of proteins required for interphase microtubule organization from the centrosome
	Recruitment of NuMA to mitotic centrosomes
	Anchoring of the basal body to the plasma membrane
	COPI-mediated anterograde transport
	COPI-independent Golgi-to-ER retrograde traffic
	AURKA Activation by TPX2

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Charcot-Marie-Tooth disease	Uncertain significance	ClinVar ClinVar, Disgenet ClinVar, Disgenet ClinVar, Disgenet	—	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
INSOMNIA	—	GWAS catalog	35835914	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (8)
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth Disease	BEFREE	26517670		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34080666	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	29864111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	34080666	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29864111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	29864111	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	16369996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35385742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
DCTN1	1	["Charcot-marie-tooth disease"]	14	["Motor proteins","Vasopressin-regulated water reabsorption","Salmonella infection","COPI-mediated anterograde transport","MHC class II antigen presentation","Regulation of PLK1 Activity at G2\/M Transition","HSP90 chaperone cycle for steroid hormone receptors (SHR)","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane"]	2	["Disgenet (Charcot-marie-tooth disease)","ClinVar (Charcot-marie-tooth disease)"]
ACTR1A	0	[]	13	["Motor proteins","Salmonella infection","COPI-mediated anterograde transport","MHC class II antigen presentation","Regulation of PLK1 Activity at G2\/M Transition","HSP90 chaperone cycle for steroid hormone receptors (SHR)","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","COPI-independent Golgi-to-ER retrograde traffic"]	0	[]
DCTN3	0	[]	13	["Motor proteins","Salmonella infection","COPI-mediated anterograde transport","MHC class II antigen presentation","Regulation of PLK1 Activity at G2\/M Transition","HSP90 chaperone cycle for steroid hormone receptors (SHR)","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","COPI-independent Golgi-to-ER retrograde traffic"]	0	[]
DYNC1H1	1	["Charcot-marie-tooth disease"]	14	["Motor proteins","Vasopressin-regulated water reabsorption","Salmonella infection","COPI-mediated anterograde transport","MHC class II antigen presentation","Regulation of PLK1 Activity at G2\/M Transition","HSP90 chaperone cycle for steroid hormone receptors (SHR)","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane"]	2	["Disgenet (Charcot-marie-tooth disease)","ClinVar (Charcot-marie-tooth disease)"]
DYNC1I2	0	[]	14	["Motor proteins","Vasopressin-regulated water reabsorption","Salmonella infection","COPI-mediated anterograde transport","MHC class II antigen presentation","Regulation of PLK1 Activity at G2\/M Transition","HSP90 chaperone cycle for steroid hormone receptors (SHR)","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane"]	0	[]

DCTN2 (dynactin subunit 2)

Save This Analysis