CPSF4L (cleavage and polyadenylation specific factor 4 like)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 642843
Gene name Cleavage and polyadenylation specific factor 4 like
Gene symbol CPSF4L
Synonyms (NCBI Gene)
-
Chromosome 17
Chromosome location 17q25.1
miRNA miRNA information provided by mirtarbase database.
6 Show/Hide all (6)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT907296 hsa-miR-122 CLIP-seq
MIRT907297 hsa-miR-1256 CLIP-seq
MIRT907298 hsa-miR-3198 CLIP-seq
MIRT907299 hsa-miR-3688-5p CLIP-seq
MIRT907300 hsa-miR-371b-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding IEA
GO:0005847 Component MRNA cleavage and polyadenylation specificity factor complex IBA
GO:0006397 Process MRNA processing IEA
GO:0008270 Function Zinc ion binding IEA
GO:0046872 Function Metal ion binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A6NMK7
Protein name Putative cleavage and polyadenylation specificity factor subunit 4-like protein
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18345 zf_CCCH_4 68 → 86 Domain
PF14608 zf-CCCH_2 123 → 142 Domain
PF14608 zf-CCCH_2 95 → 114 Domain
PF14608 zf-CCCH_2 41 → 59 Domain
PF14608 zf-CCCH_2 148 → 165 Domain
Sequence 
MQEVIAGLERFTFAFEKDVEMQKGTGLLPFQGMDKSASAVCNFFTKGLCEKGKLCPFRHD
RGEKMVVCKHWLRGLCKKGDHCKFLHQYDLTRMPECYFYSKFGDCSNKECSFLHVKPAFK
SQDCPWYDQGFCKDGPLCKYRHVPRIMCLNYLVGFCPEGPKCQFAQKIREFKLLPGSKI
Sequence length 179
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
mRNA surveillance pathway
Influenza A
Sort by:
BCL2L2-PABPN1 2 shared pathwaysmRNA surveillance pathway, Influenza A Related via 2 shared pathways including mRNA surveillance pathway, Influenza A. PABPN1L 2 shared pathwaysmRNA surveillance pathway, Influenza A Related via 2 shared pathways including mRNA surveillance pathway, Influenza A. NXT2 2 shared pathwaysmRNA surveillance pathway, Influenza A Related via 2 shared pathways including mRNA surveillance pathway, Influenza A. NXT1 2 shared pathwaysmRNA surveillance pathway, Influenza A Related via 2 shared pathways including mRNA surveillance pathway, Influenza A. NXF3 2 shared pathwaysmRNA surveillance pathway, Influenza A Related via 2 shared pathways including mRNA surveillance pathway, Influenza A.
Male infertility Linked via 2 of 5 related genesNXT2, NXF3 Prostate cancer Linked via 1 of 5 related genesBCL2L2-PABPN1 Parkinson disease Linked via 1 of 5 related genesPABPN1L