NXT1 (nuclear transport factor 2 like export factor 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 29107
• Gene name: Nuclear transport factor 2 like export factor 1
• Gene symbol: NXT1
• Synonyms (NCBI Gene): MTR2, P15
• Chromosome: 20
• Chromosome location: 20p11.21
• Summary: The protein encoded by this gene is located in the nuclear envelope. It has protein similarity to nuclear transport factor 2. This protein functions as a nuclear export factor in both RAN (Ras-related nuclear protein)- and CRM1 (required for chromosome re

miRNA Show/Hide all (31)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021904	hsa-miR-128-3p	Sequencing	20371350
MIRT028425	hsa-miR-30a-5p	Proteomics	18668040
MIRT044814	hsa-miR-320a	CLASH	23622248
MIRT043373	hsa-miR-331-3p	CLASH	23622248
MIRT1200755	hsa-miR-3180-5p	CLIP-seq
MIRT1200756	hsa-miR-425	CLIP-seq
MIRT1200757	hsa-miR-4311	CLIP-seq
MIRT1200758	hsa-miR-4727-5p	CLIP-seq
MIRT1200759	hsa-miR-4769-3p	CLIP-seq
MIRT1200760	hsa-miR-520a-5p	CLIP-seq
MIRT1200761	hsa-miR-525-5p	CLIP-seq
MIRT1200762	hsa-miR-769-5p	CLIP-seq
MIRT1200755	hsa-miR-3180-5p	CLIP-seq
MIRT2058047	hsa-miR-362-5p	CLIP-seq
MIRT2058048	hsa-miR-500b	CLIP-seq
MIRT1200760	hsa-miR-520a-5p	CLIP-seq
MIRT1200761	hsa-miR-525-5p	CLIP-seq
MIRT1200755	hsa-miR-3180-5p	CLIP-seq
MIRT2286461	hsa-miR-33a	CLIP-seq
MIRT2286462	hsa-miR-33b	CLIP-seq
MIRT2058047	hsa-miR-362-5p	CLIP-seq
MIRT2286463	hsa-miR-3646	CLIP-seq
MIRT2286464	hsa-miR-4326	CLIP-seq
MIRT2286465	hsa-miR-4464	CLIP-seq
MIRT2286466	hsa-miR-4693-3p	CLIP-seq
MIRT2286467	hsa-miR-4748	CLIP-seq
MIRT2058048	hsa-miR-500b	CLIP-seq
MIRT1200760	hsa-miR-520a-5p	CLIP-seq
MIRT1200761	hsa-miR-525-5p	CLIP-seq
MIRT2286468	hsa-miR-581	CLIP-seq
MIRT2286469	hsa-miR-759	CLIP-seq

Gene ontology (GO) Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	11566096, 11583626, 12483225, 14729961, 16189514, 17267598, 19060904, 23299939, 25416956, 28514442, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IDA	25628361
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005643	Component	Nuclear pore	IEA
GO:0005643	Component	Nuclear pore	TAS	10567585
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	10567585
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006405	Process	RNA export from nucleus	IEA
GO:0006406	Process	MRNA export from nucleus	IDA	25628361
GO:0006406	Process	MRNA export from nucleus	ISS
GO:0006611	Process	Protein export from nucleus	IEA
GO:0006913	Process	Nucleocytoplasmic transport	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016607	Component	Nuclear speck	IEA
GO:0016973	Process	Poly(A)+ mRNA export from nucleus	IBA
GO:0031267	Function	Small GTPase binding	IEA
GO:0042272	Component	Nuclear RNA export factor complex	IEA
GO:0042272	Component	Nuclear RNA export factor complex	IPI	25628361
GO:0042272	Component	Nuclear RNA export factor complex	ISS
GO:0044613	Component	Nuclear pore central transport channel	IBA

Other IDs

• MIM: 605811
• HGNC: 15913
• e!Ensembl: ENSG00000132661

Protein

• UniProt ID: Q9UKK6
• Protein name: NTF2-related export protein 1 (Protein p15)
• Protein function: Stimulator of protein export for NES-containing proteins (PubMed:10567585). Also plays a role in the nuclear export of U1 snRNA, tRNA, and mRNA (PubMed:10848583). The NXF1-NXT1 heterodimer is involved in the export of HSP70 mRNA in conjunction w
• PDB: 1JKG , 1JN5 , 4WYK , 6E5U
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02136	NTF2	16 → 135	Nuclear transport factor 2 (NTF2) domain	Domain

• Sequence:

  MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSE
  FFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQAS
  PSNTVWKIASDCFRFQDWAS

• Sequence length: 140

Pathways

KEGG Pathway	Reactome Pathway
Ribosome biogenesis in eukaryotes	Transport of Mature mRNA derived from an Intron-Containing Transcript
Nucleocytoplasmic transport
mRNA surveillance pathway
Amyotrophic lateral sclerosis
Influenza A

Related Genes

Sort by: Blended Diseases Pathways Evidence source

NXF2 5 shared pathwaysRibosome biogenesis in eukaryotes, Nucleocytoplasmic transport, mRNA surveillance pathway, Influenza A, Transport of Mature mRNA derived from an Intron-Containing Transcript Related via 5 shared pathways including Ribosome biogenesis in eukaryotes, Nucleocytoplasmic transport. NXF2B 5 shared pathwaysRibosome biogenesis in eukaryotes, Nucleocytoplasmic transport, mRNA surveillance pathway, Influenza A, Transport of Mature mRNA derived from an Intron-Containing Transcript Related via 5 shared pathways including Ribosome biogenesis in eukaryotes, Nucleocytoplasmic transport. NXT2 4 shared pathwaysRibosome biogenesis in eukaryotes, Nucleocytoplasmic transport, mRNA surveillance pathway, Influenza A Related via 4 shared pathways including Ribosome biogenesis in eukaryotes, Nucleocytoplasmic transport. NXF3 4 shared pathwaysRibosome biogenesis in eukaryotes, Nucleocytoplasmic transport, mRNA surveillance pathway, Influenza A Related via 4 shared pathways including Ribosome biogenesis in eukaryotes, Nucleocytoplasmic transport. GLE1 3 shared pathwaysNucleocytoplasmic transport, mRNA surveillance pathway, Transport of Mature mRNA derived from an Intron-Containing Transcript Related via 3 shared pathways including Nucleocytoplasmic transport, mRNA surveillance pathway.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
NXF2	0	[]	5	["Ribosome biogenesis in eukaryotes","Nucleocytoplasmic transport","mRNA surveillance pathway","Influenza A","Transport of Mature mRNA derived from an Intron-Containing Transcript"]	0	[]
NXF2B	0	[]	5	["Ribosome biogenesis in eukaryotes","Nucleocytoplasmic transport","mRNA surveillance pathway","Influenza A","Transport of Mature mRNA derived from an Intron-Containing Transcript"]	0	[]
NXT2	0	[]	4	["Ribosome biogenesis in eukaryotes","Nucleocytoplasmic transport","mRNA surveillance pathway","Influenza A"]	0	[]
NXF3	0	[]	4	["Ribosome biogenesis in eukaryotes","Nucleocytoplasmic transport","mRNA surveillance pathway","Influenza A"]	0	[]
GLE1	0	[]	3	["Nucleocytoplasmic transport","mRNA surveillance pathway","Transport of Mature mRNA derived from an Intron-Containing Transcript"]	0	[]

Diseases Linked via Similar Genes

Male infertility Linked via 2 of 5 related genesNXT2, NXF3 Amyotrophic lateral sclerosis Linked via 1 of 5 related genesGLE1 Arthrogryposis with anterior horn cell disease Linked via 1 of 5 related genesGLE1 Congenital arthrogryposis with anterior horn cell disease Linked via 1 of 5 related genesGLE1 Hypertension Linked via 1 of 5 related genesGLE1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Male infertility	2	["NXT2","NXF3"]
Amyotrophic lateral sclerosis	1	["GLE1"]
Arthrogryposis with anterior horn cell disease	1	["GLE1"]
Congenital arthrogryposis with anterior horn cell disease	1	["GLE1"]
Hypertension	1	["GLE1"]